StarFunc result for job id Q5VT25

User Input

>input (1732 residues)
MSGEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWA
KPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETA
CFREERDVLVNGDNKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARF
YLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGT
PDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKER
FQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIP
EVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTA
GPTSLDLDVNVQRTLDNNLATEAYERRIKRLEQEKLELSRKLQESTQTVQALQYSTVDGP
LTASKDLEIKNLKEEIEKLRKQVTESSHLEQQLEEANAVRQELDDAFRQIKAYEKQIKTL
QQEREDLNKELVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHV
RDKEEEVDLVMQKVESLRQELRRTERAKKELEVHTEALAAEASKDRKLREQSEHYSKQLE
NELEGLKQKQISYSPGVCSIEHQQEITKLKTDLEKKSIFYEEELSKREGIHANEIKNLKK
ELHDSEGQQLALNKEIMILKDKLEKTRRESQSEREEFESEFKQQYEREKVLLTEENKKLT
SELDKLTTLYENLSIHNQQLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQA
LASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEEL
NKVKASNIITECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTP
TDALDQFERSPSCTPASKGRRTVDSTPLSVHTPTLRKKGCPGSTGFPPKRKTHQFFVKSF
TTPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCVNKAPTTCPVPPEQTKGPLGIDPQKG
IGTAYEGHVRIPKPAGVKKGWQRALAIVCDFKLFLYDIAEGKASQPSVVISQVIDMRDEE
FSVSSVLASDVIHASRKDIPCIFRVTASQLSASNNKCSILMLADTENEKNKWVGVLSELH
KILKKNKFRDRSVYVPKEAYDSTLPLIKTTQAAAIIDHERIALGNEEGLFVVHVTKDEII
RVGDNKKIHQIELIPNDQLVAVISGRNRHVRLFPMSALDGRETDFYKLSETKGCQTVTSG
KVRHGALTCLCVAMKRQVLCYELFQSKTRHRKFKEIQVPYNVQWMAIFSEQLCVGFQSGF
LRYPLNGEGNPYSMLHSNDHTLSFIAHQPMDAICAVEISSKEYLLCFNSIGIYTDCQGRR
SRQQELMWPANPSSCCYNAPYLSVYSENAVDIFDVNSMEWIQTLPLKKVRPLNNEGSLNL
LGLETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNINNKRRYSFRVPEEERMQQRREM
LRDPEMRNKLISNPTNFNHIAHMGPGDGIQILKDLPMNPRPQESRTVFSGSVSIPSITKS
RPEPGRSMSASSGLSARSSAQNGSALKREFSGGSYSAKRQPMPSPSEGSLSSGGMDQGSD
APARDFDGEDSDSPRHSTASNSSNLSSPPSPASPRKTKSLSLESTDRGSWDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O01583	0.321	0.342	0.000	1592	0.361	0.393	O01583.pdb.gz	MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans OX=6239 GN=mrck-1 PE=1 SV=3
2	AFDB:O54874	0.358	0.358	0.000	1732	0.959	0.959	O54874.pdb.gz	MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus OX=10116 GN=Cdc42bpa PE=1 SV=1
3	AFDB:Q6DT37	0.324	0.356	0.000	1551	0.428	0.478	Q6DT37.pdb.gz	MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens OX=9606 GN=CDC42BPG PE=1 SV=2
4	AFDB:Q7TT49	0.374	0.377	0.000	1713	0.608	0.615	Q7TT49.pdb.gz	MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus OX=10116 GN=Cdc42bpb PE=1 SV=1
5	AFDB:Q9W1B0	0.298	0.315	0.000	1637	0.421	0.446	Q9W1B0.pdb.gz	GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster OX=7227 GN=gek PE=1 SV=1
6	AFDB:E9PSL7	0.219	0.186	1.822E-75	2055	0.249	0.210	E9PSL7.pdb.gz	CTRO_RAT Citron rho-interacting kinase OS=Rattus norvegicus OX=10116 GN=Cit PE=1 SV=1
7	AFDB:O14578	0.248	0.214	4.100E-75	2027	0.259	0.221	O14578.pdb.gz	CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens OX=9606 GN=CIT PE=1 SV=2
8	AFDB:Q09013	0.228	0.615	3.128E-48	629	0.155	0.426	Q09013.pdb.gz	DMPK_HUMAN Myotonin-protein kinase OS=Homo sapiens OX=9606 GN=DMPK PE=1 SV=3
9	AFDB:D3ZYV4	0.226	0.616	5.084E-47	626	0.154	0.425	D3ZYV4.pdb.gz	D3ZYV4_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Dmpk PE=3 SV=4
10	AFDB:A0A0R4IVY5	0.224	0.283	1.716E-46	1359	0.201	0.256	A0A0R4IVY5.pdb.gz	A0A0R4IVY5_DANRE Rho-associated protein kinase OS=Danio rerio OX=7955 GN=rock1 PE=1 SV=2
11	PDB:6byrA	0.171	0.700	2.139E-26	405	0.068	0.289	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
12	PDB:3pfqA	0.171	0.539	5.372E-24	523	0.065	0.216	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
13	PDB:5x3fB	0.153	0.714	6.579E-24	349	0.061	0.304	5x3fB.pdb.gz
14	PDB:4yhjA	0.172	0.566	1.149E-23	501	0.055	0.192	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
15	PDB:6pjxA	0.175	0.536	3.688E-23	543	0.054	0.171	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
16	PDB:3nynA	0.173	0.520	1.069E-22	554	0.053	0.166	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
17	PDB:4mk0A	0.171	0.445	1.868E-22	631	0.062	0.170	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
18	PDB:3c4wB	0.167	0.531	2.174E-22	519	0.054	0.179	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
19	PDB:3pvuA	0.157	0.429	3.432E-22	609	0.056	0.159	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
20	PDB:5dykA	0.158	0.331	8.991E-22	809	0.054	0.115	5dykA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O01583	0.0	1097	1592	0.377	0.410	MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans OX=6239 GN=mrck-1 PE=1 SV=3
2	O54874	0.0	3454	1732	0.959	0.959	MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus OX=10116 GN=Cdc42bpa PE=1 SV=1
3	Q3UU96	0.0	3424	1719	0.954	0.961	MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus OX=10090 GN=Cdc42bpa PE=1 SV=2
4	Q5VT25	0.0	3613	1732	1.000	1.000	MRCKA_HUMAN Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens OX=9606 GN=CDC42BPA PE=1 SV=1
5	Q6DT37	0.0	1323	1551	0.432	0.482	MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens OX=9606 GN=CDC42BPG PE=1 SV=2
6	Q7TT49	0.0	2142	1713	0.602	0.609	MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus OX=10116 GN=Cdc42bpb PE=1 SV=1
7	Q7TT50	0.0	2140	1713	0.602	0.609	MRCKB_MOUSE Serine/threonine-protein kinase MRCK beta OS=Mus musculus OX=10090 GN=Cdc42bpb PE=1 SV=2
8	Q86XZ8	0.0	805	492	0.212	0.748	Q86XZ8_HUMAN CDC42BPB protein (Fragment) OS=Homo sapiens OX=9606 GN=CDC42BPB PE=2 SV=1
9	Q9W1B0	0.0	1167	1637	0.393	0.415	GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster OX=7227 GN=gek PE=1 SV=1
10	Q9Y5S2	0.0	2149	1711	0.604	0.611	MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2
11	Q09013	1.61e-160	505	629	0.158	0.434	DMPK_HUMAN Myotonin-protein kinase OS=Homo sapiens OX=9606 GN=DMPK PE=1 SV=3
12	A0A8I6ANX6	1.31e-159	504	651	0.155	0.413	A0A8I6ANX6_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Dmpk PE=3 SV=1
13	P54265	1.45e-156	495	631	0.154	0.423	DMPK_MOUSE Myotonin-protein kinase OS=Mus musculus OX=10090 GN=Dmpk PE=1 SV=1
14	D3ZYV4	2.84e-140	449	605	0.149	0.426	D3ZYV4_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Dmpk PE=3 SV=4
15	F1MF50	6.09e-131	446	1356	0.220	0.281	F1MF50_BOVIN Rho-associated protein kinase OS=Bos taurus OX=9913 GN=ROCK1 PE=3 SV=3
16	A0A0R4IVY5	3.36e-130	444	1359	0.144	0.183	A0A0R4IVY5_DANRE Rho-associated protein kinase OS=Danio rerio OX=7955 GN=rock1 PE=1 SV=2
17	Q63644	5.42e-130	443	1369	0.151	0.191	ROCK1_RAT Rho-associated protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Rock1 PE=1 SV=1
18	I3LFH3	1.15e-129	437	1134	0.141	0.216	I3LFH3_PIG non-specific serine/threonine protein kinase OS=Sus scrofa OX=9823 GN=ROCK1 PE=1 SV=4
19	P70335	1.85e-128	439	1354	0.149	0.191	ROCK1_MOUSE Rho-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Rock1 PE=1 SV=1
20	A0A8C0NIR0	2.56e-128	438	1355	0.148	0.190	A0A8C0NIR0_CANLF Rho-associated protein kinase OS=Canis lupus familiaris OX=9615 GN=ROCK1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	1.8e-06	39.1	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF00780 CNH	2e-69	245.8	CNH domain
3	PF08826 DMPK_coil	2.7e-23	93.2	DMPK coiled coil domain like
4	PF15796 KELK	5.9e-28	108.4	KELK-motif containing domain of MRCK Ser/Thr protein kinase
5	PF11887 Mce4_CUP1	5.7e+02	11.5	Cholesterol uptake porter CUP1 of Mce4, putative
6	PF00786 PBD	64	15.3	P21-Rho-binding domain
7	PF00169 PH	71	15.3	PH domain
8	PF00069 Pkinase	7.1e-52	188.0	Protein kinase domain
9	PF00433 Pkinase_C	0.36	22.9	Protein kinase C terminal domain
10	PF07714 PK_Tyr_Ser-Thr	6.4e-26	102.8	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008966053.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003804292.1	0.907	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 754 ESTs, 35 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
2	9597.XP_003814005.1	0.907	Cell division control protein 42 homolog isoform X1
3	9597.XP_008971161.1	0.907	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
4	9597.XP_008960504.1	0.777	Protein phosphatase 1 regulatory subunit 12C
5	9597.XP_003832516.1	0.745	Myosin light chain 2
6	9597.XP_008963388.1	0.745	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family
7	9597.XP_003812805.1	0.727	Leucine rich adaptor protein 1
8	9597.XP_003818417.1	0.725	Ras homolog family member A
9	9597.XP_008961300.1	0.721	Ras homolog family member C
10	9597.XP_003827060.1	0.697	Ras homolog family member B
11	9597.XP_008957488.1	0.693	Myosin regulatory light chain 10
12	9597.XP_008971846.1	0.675	Afadin, adherens junction formation factor
13	9597.XP_008966792.1	0.671	LIM domain kinase 1
14	9597.XP_008950527.1	0.664	LIM domain kinase 2
15	9597.XP_003832918.1	0.658	Protein phosphatase 1 regulatory subunit 12A isoform X1
16	9597.XP_008974872.1	0.658	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 34 ESTs, 4 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
17	9597.XP_003805721.1	0.648	Rho GTPase activating protein 6
18	9597.XP_003823106.1	0.614	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family
19	9597.XP_003831931.1	0.600	Myosin light chain 9
20	9597.XP_003817939.1	0.597	Myosin light chain 12B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0000287	0.954	magnesium ion binding
GO:0000166	0.949	nucleotide binding
GO:0042802	0.946	identical protein binding
GO:0005524	0.943	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0007010	0.992	cytoskeleton organization
GO:0030036	0.934	actin cytoskeleton organization
GO:0050789	0.933	regulation of biological process
GO:0050794	0.852	regulation of cellular process
GO:0071704	0.820	organic substance metabolic process
GO:0044237	0.794	cellular metabolic process
GO:0044238	0.792	primary metabolic process
GO:0006468	0.749	protein phosphorylation
GO:0031032	0.693	actomyosin structure organization
GO:0048870	0.583	cell motility
GO:0016477	0.415	cell migration
GO:0050896	0.355	response to stimulus
GO:0048518	0.321	positive regulation of biological process
GO:0048583	0.318	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0043227	0.997	membrane-bounded organelle
GO:0005856	0.988	cytoskeleton
GO:0005829	0.985	cytosol
GO:0015629	0.984	actin cytoskeleton
GO:0005576	0.954	extracellular region
GO:0042641	0.951	actomyosin
GO:0031982	0.886	vesicle
GO:0005615	0.878	extracellular space
GO:0070062	0.872	extracellular exosome
GO:0016020	0.766	membrane
GO:0043231	0.694	intracellular membrane-bounded organelle
GO:0031252	0.487	cell leading edge
GO:0030054	0.336	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]