StarFunc result for job id Q5VT40

User Input

>input (261 residues)
MGCIQSITCKARIRRENIVVYDVCATIDQCPTRIEETSPIVLRYKTPYFKASARVVMPPI
PRHETWVVGWIQACNQMEFFNTYSDLGMSSWELPDLREGRVKAISDSDGVSYPWYGNTTE
TVTLVGPTNKISRFSVSMNDNFYPSVTWAVPVSDSNVPLLTRIKRDQSFTTWLVAMNTTT
KEKIILQTIKWRMRVDIEVDPLQLLGQRARLVGRTQQEQPRILSRMEPIPPNALVKPNAN
DAQVLMWRPKRGPPLVVIPPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JUQ0	0.966	0.892	3.685E-41	283	0.716	0.661	Q5JUQ0.pdb.gz	FA78A_HUMAN Protein FAM78A OS=Homo sapiens OX=9606 GN=FAM78A PE=1 SV=1
2	AFDB:Q9LNP3	0.206	0.204	1.718E-3	264	0.073	0.072	Q9LNP3.pdb.gz	Q9LNP3_ARATH At1g17620/F11A6_23 OS=Arabidopsis thaliana OX=3702 GN=At1g17620 PE=1 SV=1
3	AFDB:Q8LD98	0.140	0.143	3.524E-3	252	0.073	0.075	Q8LD98.pdb.gz	NHL6_ARATH NDR1/HIN1-like protein 6 OS=Arabidopsis thaliana OX=3702 GN=NHL6 PE=1 SV=1
4	AFDB:Q9M132	0.168	0.184	3.710E-3	227	0.080	0.093	Q9M132.pdb.gz	Q9M132_ARATH At4g01410 OS=Arabidopsis thaliana OX=3702 GN=At4g01410 PE=1 SV=1
5	AFDB:F4K5V1	0.166	0.171	5.888E-3	248	0.073	0.077	F4K5V1.pdb.gz	F4K5V1_ARATH NDR1/HIN1-like 25 OS=Arabidopsis thaliana OX=3702 GN=NHL25 PE=4 SV=1
6	AFDB:Q9C636	0.205	0.170	7.230E-3	342	0.096	0.073	Q9C636.pdb.gz	Q9C636_ARATH Transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=CC1 PE=1 SV=1
7	AFDB:Q9SRN1	0.190	0.199	1.147E-2	240	0.084	0.092	Q9SRN1.pdb.gz	NHL2_ARATH NDR1/HIN1-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=NHL2 PE=2 SV=1
8	AFDB:Q9C568	0.182	0.213	1.208E-2	210	0.046	0.057	Q9C568.pdb.gz	Q9C568_ARATH Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family OS=Arabidopsis thaliana OX=3702 GN=At5g22200 PE=1 SV=1
9	PDB:1yycA	0.172	0.222	1.333E-2	174	0.077	0.115	1yycA.pdb.gz
10	AFDB:Q9SJ52	0.192	0.209	1.483E-2	227	0.103	0.119	Q9SJ52.pdb.gz	NHL10_ARATH NDR1/HIN1-like protein 10 OS=Arabidopsis thaliana OX=3702 GN=NHL10 PE=2 SV=1
11	AFDB:Q9FNH6	0.198	0.215	1.561E-2	231	0.084	0.095	Q9FNH6.pdb.gz	NHL3_ARATH NDR1/HIN1-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=NHL3 PE=1 SV=1
12	PDB:1preB	0.121	0.080	3.719E-2	451	0.073	0.042	1preB.pdb.gz
13	PDB:2ag2A	0.191	0.264	8.031E-2	164	0.065	0.104	2ag2A.pdb.gz	Crystal Structure Analysis of Phosphatidylcholine-GM2-Activator Product Complexes: Evidence for Hydrolase Activity.
14	PDB:6u3tB	0.135	0.138	9.368E-2	253	0.096	0.099	6u3tB.pdb.gz	Structure-based discovery of a small-molecule inhibitor of methicillin-resistantStaphylococcus aureusvirulence.
15	PDB:3b07B	0.143	0.139	1.038E-1	270	0.054	0.052	3b07B.pdb.gz
16	PDB:3apnA	0.126	0.071	1.211E-1	563	0.065	0.030	3apnA.pdb.gz
17	PDB:5n0zA	0.115	0.062	1.275E-1	638	0.065	0.027	5n0zA.pdb.gz	Development of a Selective Inhibitor of Protein Arginine Deiminase 2.
18	PDB:6o22D	0.170	0.232	1.487E-1	164	0.080	0.128	6o22D.pdb.gz
19	PDB:7tysA	0.142	0.111	1.565E-1	361	0.080	0.058	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
20	PDB:3gd1E	0.188	0.171	1.648E-1	300	0.042	0.037	3gd1E.pdb.gz	Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5JUQ0	2.96e-138	392	283	0.720	0.664	FA78A_HUMAN Protein FAM78A OS=Homo sapiens OX=9606 GN=FAM78A PE=1 SV=1
2	Q8TE67	0.60	33.9	593	0.100	0.044	ES8L3_HUMAN Epidermal growth factor receptor kinase substrate 8-like protein 3 OS=Homo sapiens OX=9606 GN=EPS8L3 PE=1 SV=2
3	P0A799	0.88	33.1	387	0.065	0.044	PGK_ECOLI Phosphoglycerate kinase OS=Escherichia coli (strain K12) OX=83333 GN=pgk PE=1 SV=2
4	Q9LMX7	6.0	30.8	517	0.057	0.029	C78A5_ARATH Cytochrome P450 78A5 OS=Arabidopsis thaliana OX=3702 GN=CYP78A5 PE=2 SV=1
5	Q8CJ40	9.2	30.4	2009	0.054	0.007	CROCC_MOUSE Rootletin OS=Mus musculus OX=10090 GN=Crocc PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008846456.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008832169.1	0.625	ATP synthase, H+ transporting, mitochondrial Fo complex subunit B1
2	1026970.XP_008840727.1	0.585	Protein FAM107B
3	1026970.XP_008822322.1	0.537	Retinitis pigmentosa 2 (X-linked recessive)
4	1026970.XP_008822673.1	0.504	Gamma-synuclein
5	1026970.XP_008841915.1	0.502	Progestin and adipoQ receptor family member 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.883	biological regulation
GO:0050789	0.867	regulation of biological process
GO:0009987	0.761	cellular process
GO:0050794	0.580	regulation of cellular process
GO:0051701	0.563	biological process involved in interaction with host
GO:0016032	0.545	viral process
GO:0019048	0.357	modulation by virus of host process
GO:0052553	0.357	modulation by symbiont of host immune response
GO:0019054	0.354	modulation by virus of host cellular process
GO:0075528	0.338	modulation by virus of host immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005622	0.940	intracellular anatomical structure
GO:0005737	0.864	cytoplasm
GO:0043229	0.740	intracellular organelle
GO:0043227	0.739	membrane-bounded organelle
GO:0016020	0.685	membrane
GO:0043231	0.683	intracellular membrane-bounded organelle
GO:0043657	0.397	host cell
GO:0071944	0.392	cell periphery
GO:0033648	0.390	host intracellular membrane-bounded organelle
GO:0042025	0.347	host cell nucleus
GO:0044423	0.327	virion component

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]