StarFunc result for job id Q5VT52

User Input

>input (1461 residues)
MAAGGGGGSSKASSSSASSAGALESSLDRKFQSVTNTMESIQGLSSWCIENKKHHSTIVY
HWMKWLRRSAYPHRLNLFYLANDVIQNCKRKNAIIFRESFADVLPEAAALVKDPSVSKSV
ERIFKIWEDRNVYPEEMIVALREALSTTFKTQKQLKENLNKQPNKQWKKSQTSTNPKAAL
KSKIVAEFRSQALIEELLLYKRSEDQIELKEKQLSTMRVDVCSTETLKCLKDKTGGKKFS
KEFEEASSKLEEFVNGLDKQVKNGPSLTEALENAGIFYEAQYKEVKVVANAYKTFANRVN
NLKKKLDQLKSTLPDPEESPVPSPSMDAPSPTGSESPFQGMGGEESQSPTMESEKSATPE
PVTDNRDVEDMELSDVEDDGSKIIVEDRKEKPAEKSAVSTSVPTKPTENISKASSCTPVP
VTMTATPPLPKPVNTSLSPSPALALPNLANVDLAKISSILSSLTSVMKNTGVSPASRPSP
GTPTSPSNLTSGLKTPAPATTTSHNPLANILSKVEITPESILSALSKTQTQSAPALQGLS
SLLQSVTGNPVPASEAASQSTSASPANTTVSTIKGRNLPSSAQPFIPKSFNYSPNSSTSE
VSSTSASKASIGQSPGLPSTTFKLPSNSLGFTATHNTSPAAPPTEVTICQSSEVSKPKLE
SESTSPSLEMKIHNFLKGNPGFSGLNLNIPILSSLGSSAPSESHPSDFQRGPTSTSIDNI
DGTPVRDERSGTPTQDEMMDKPTSSSVDTMSLLSKIISPGSSTPSSTRSPPPGRDESYPR
ELSNSVSTYRPFGLGSESPYKQPSDGMERPSSLMDSSQEKFYPDTSFQEDEDYRDFEYSG
PPPSAMMNLEKKPAKSILKSSKLSDTTEYQPILSSYSHRAQEFGVKSAFPPSVRALLDSS
ENCDRLSSSPGLFGAFSVRGNEPGSDRSPSPSKNDSFFTPDSNHNSLSQSTTGHLSLPQK
QYPDSPHPVPHRSLFSPQNTLAAPTGHPPTSGVEKVLASTISTTSTIEFKNMLKNASRKP
SDDKHFGQAPSKGTPSDGVSLSNLTQPSLTATDQQQQEEHYRIETRVSSSCLDLPDSTEE
KGAPIETLGYHSASNRRMSGEPIQTVESIRVPGKGNRGHGREASRVGWFDLSTSGSSFDN
GPSSASELASLGGGGSGGLTGFKTAPYKERAPQFQESVGSFRSNSFNSTFEHHLPPSPLE
HGTPFQREPVGPSSAPPVPPKDHGGIFSRDAPTHLPSVDLSNPFTKEAALAHAAPPPPPG
EHSGIPFPTPPPPPPPGEHSSSGGSGVPFSTPPPPPPPVDHSGVVPFPAPPLAEHGVAGA
VAVFPKDHSSLLQGTLAEHFGVLPGPRDHGGPTQRDLNGPGLSRVRESLTLPSHSLEHLG
PPHGGGGGGGSNSSSGPPLGPSHRDTISRSGIILRSPRPDFRPREPFLSRDPFHSLKRPR
PPFARGPPFFAPKRPFFPPRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VT52	1.000	1.000	0.000	1461	1.000	1.000	Q5VT52.pdb.gz	RPRD2_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2 PE=1 SV=1
2	AFDB:O94913	0.092	0.087	7.518E-7	1555	0.155	0.145	O94913.pdb.gz	PCF11_HUMAN Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3
3	AFDB:Q9UPN6	0.090	0.103	3.430E-5	1271	0.134	0.154	Q9UPN6.pdb.gz	SCAF8_HUMAN SR-related and CTD-associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1
4	AFDB:P21263	0.046	0.039	3.736E-4	1893	0.156	0.120	P21263.pdb.gz	NEST_RAT Nestin OS=Rattus norvegicus OX=10116 GN=Nes PE=1 SV=2
5	AFDB:P86839	0.048	0.054	6.351E-4	1265	0.128	0.148	P86839.pdb.gz	NEST_DANRE Nestin OS=Danio rerio OX=7955 GN=nes PE=2 SV=1
6	AFDB:Q9Z1Q1	0.050	0.042	9.208E-4	1818	0.152	0.122	Q9Z1Q1.pdb.gz	NEST_MESAU Nestin (Fragments) OS=Mesocricetus auratus OX=10036 GN=NES PE=1 SV=2
7	AFDB:G3V9G5	0.054	0.052	1.266E-3	1557	0.161	0.151	G3V9G5.pdb.gz	G3V9G5_RAT Synemin OS=Rattus norvegicus OX=10116 GN=Synm PE=1 SV=2
8	AFDB:Q70IV5	0.048	0.046	1.741E-3	1561	0.152	0.142	Q70IV5.pdb.gz	SYNEM_MOUSE Synemin OS=Mus musculus OX=10090 GN=Synm PE=1 SV=2
9	AFDB:Q80U93	0.040	0.031	1.741E-3	2085	0.167	0.117	Q80U93.pdb.gz	NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus OX=10090 GN=Nup214 PE=1 SV=2
10	AFDB:P48681	0.049	0.045	1.936E-3	1621	0.152	0.137	P48681.pdb.gz	NEST_HUMAN Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2
11	PDB:7oo3c	0.073	0.586	6.215E-2	141	0.014	0.149	7oo3c.pdb.gz	Structural basis of human transcription-DNA repair coupling.
12	PDB:6tedQ	0.043	0.065	2.221E-1	890	0.024	0.039	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
13	PDB:7sn8D	0.061	0.177	3.053E-1	399	0.022	0.080	7sn8D.pdb.gz	Inositol hexakisphosphate is required for Integrator function.
14	PDB:6lojB	0.045	0.077	3.580E-1	571	0.023	0.060	6lojB.pdb.gz	Substrate-binding destabilizes the hydrophobic cluster to relieve the autoinhibition of bacterial ubiquitin ligase IpaH9.8.
15	PDB:7ohrI	0.045	0.115	3.981E-1	409	0.027	0.095	7ohrI.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
16	PDB:7jv7C	0.076	0.366	5.473E-1	250	0.014	0.084	7jv7C.pdb.gz
17	PDB:7zu0A	0.047	0.067	5.473E-1	954	0.025	0.039	7zu0A.pdb.gz
18	PDB:3hajA	0.041	0.149	6.086E-1	286	0.028	0.143	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
19	PDB:4hnxA	0.038	0.063	6.768E-1	713	0.023	0.046	4hnxA.pdb.gz	The Protein Complex NatA Binds Inositol Hexakisphosphate and Exhibits Conformational Flexibility
20	PDB:1ihgA	0.053	0.158	7.137E-1	364	0.013	0.052	1ihgA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5VT52	0.0	2931	1461	1.000	1.000	RPRD2_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2 PE=1 SV=1
2	Q96P16	2.46e-21	99.0	312	0.060	0.279	RPR1A_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Homo sapiens OX=9606 GN=RPRD1A PE=1 SV=1
3	Q9NQG5	2.94e-19	92.8	326	0.034	0.153	RPR1B_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Homo sapiens OX=9606 GN=RPRD1B PE=1 SV=1
4	A0A0P0WFI1	1.35e-14	80.9	528	0.029	0.081	A0A0P0WFI1_ORYSJ Os04g0636700 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0636700 PE=1 SV=1
5	Q9XVN9	5.63e-11	69.7	658	0.054	0.120	Q9XVN9_CAEEL CID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cids-2 PE=1 SV=2
6	A5Z2V0	4.14e-10	67.0	662	0.053	0.116	A5Z2V0_CAEEL CID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cids-2 PE=1 SV=1
7	A5Z2V1	9.59e-10	65.5	664	0.052	0.114	A5Z2V1_CAEEL CID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cids-2 PE=1 SV=1
8	Q8I4J5	1.03e-09	65.5	656	0.054	0.120	Q8I4J5_CAEEL CID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cids-2 PE=1 SV=2
9	P34281	1.04e-07	57.8	315	0.023	0.105	CIDS1_CAEEL CID domain-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=cids-1 PE=4 SV=2
10	O74814	9.36e-06	52.0	387	0.023	0.085	YJ03_SCHPO UPF0400 protein C337.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC337.03 PE=1 SV=1
11	Q05543	1.00e-05	52.0	409	0.020	0.071	RT103_YEAST Regulator of Ty1 transposition protein 103 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTT103 PE=1 SV=1
12	Q9XER9	0.003	44.7	1392	0.025	0.026	HUA2_ARATH ENHANCER OF AG-4 protein 2 OS=Arabidopsis thaliana OX=3702 GN=HUA2 PE=2 SV=1
13	Q5ABD0	1.1	35.4	226	0.027	0.177	SNF7_CANAL Vacuolar-sorting protein SNF7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNF7 PE=3 SV=1
14	P19835	8.3	33.5	753	0.033	0.064	CEL_HUMAN Bile salt-activated lipase OS=Homo sapiens OX=9606 GN=CEL PE=1 SV=3
15	Q9Y091	8.7	33.1	536	0.015	0.041	FL2D_DROME Pre-mRNA-splicing regulator female-lethal(2)D OS=Drosophila melanogaster OX=7227 GN=fl(2)d PE=1 SV=2
16	Q9WTQ2	9.9	33.1	485	0.034	0.101	PODXL_RAT Podocalyxin OS=Rattus norvegicus OX=10116 GN=Podxl PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04818 CID	8.6e-25	98.8	CID domain
2	PF16566 CREPT	0.0031	29.1	Cell-cycle alteration and expression-elevated protein in tumour
3	PF08463 EcoEI_R_C	2e+02	13.5	EcoEI R protein C-terminal
4	PF14200 RicinB_lectin_2	6.1e+02	12.5	Ricin-type beta-trefoil lectin domain-like
5	PF18052 Rx_N	2.2e+02	13.5	Rx N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358064

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362532	0.961	Regulation of nuclear pre-mRNA domain-containing protein 1B
2	9606.ENSP00000476948	0.955	Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2
3	9606.ENSP00000301788	0.952	DNA-directed RNA polymerase II subunit RPB7
4	9606.ENSP00000381984	0.839	Regulation of nuclear pre-mRNA domain-containing protein 1A
5	9606.ENSP00000480158	0.821	DNA-directed RNA polymerase II subunit RPB1
6	9606.ENSP00000298281	0.800	Pre-mRNA cleavage complex 2 protein Pcf11
7	9606.ENSP00000408429	0.788	Integrator complex subunit 14
8	9606.ENSP00000261191	0.779	Integrator complex subunit 13
9	9606.ENSP00000299601	0.767	RNA polymerase-associated protein LEO1
10	9606.ENSP00000470252	0.765	Transcription elongation factor SPT5
11	9606.ENSP00000414237	0.764	Integrator complex subunit 2
12	9606.ENSP00000272645	0.761	DNA-directed RNA polymerase II subunit RPB4
13	9606.ENSP00000415433	0.760	Integrator complex subunit 12
14	9606.ENSP00000403683	0.739	SOSS complex subunit B2
15	9606.ENSP00000413098	0.739	Protein SCAF8
16	9606.ENSP00000370200	0.704	snRNA-activating protein complex subunit 3
17	9606.ENSP00000286835	0.701	Splicing factor, arginine/serine-rich 15
18	9606.ENSP00000363139	0.699	CD164 molecule like 2
19	9606.ENSP00000478303	0.699	DNA-directed RNA polymerases I, II, and III subunit RPABC1
20	9606.ENSP00000264157	0.693	Cyclin-T2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.452	heterocyclic compound binding
GO:0097159	0.452	organic cyclic compound binding
GO:0003676	0.436	nucleic acid binding
GO:0019899	0.324	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.982	primary metabolic process
GO:0044237	0.982	cellular metabolic process
GO:0006807	0.978	nitrogen compound metabolic process
GO:0043170	0.971	macromolecule metabolic process
GO:1901360	0.965	organic cyclic compound metabolic process
GO:0010467	0.955	gene expression
GO:0016070	0.955	RNA metabolic process
GO:0050794	0.954	regulation of cellular process
GO:0019222	0.831	regulation of metabolic process
GO:0060255	0.813	regulation of macromolecule metabolic process
GO:0051171	0.777	regulation of nitrogen compound metabolic process
GO:0080090	0.669	regulation of primary metabolic process
GO:0031323	0.666	regulation of cellular metabolic process
GO:0019219	0.479	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.477	regulation of gene expression
GO:0009889	0.459	regulation of biosynthetic process
GO:0031326	0.450	regulation of cellular biosynthetic process
GO:0010556	0.448	regulation of macromolecule biosynthetic process
GO:0051252	0.438	regulation of RNA metabolic process
GO:0051179	0.397	localization
GO:0048518	0.370	positive regulation of biological process
GO:0009893	0.356	positive regulation of metabolic process
GO:0048522	0.329	positive regulation of cellular process
GO:2001141	0.310	regulation of RNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016591	0.995	RNA polymerase II, holoenzyme
GO:0005737	0.634	cytoplasm
GO:0016604	0.345	nuclear body
GO:0043232	0.312	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]