StarFunc result for job id Q5VT66

User Input

>input (337 residues)
MGAAGSSALARFVLLAQSRPGWLGVAALGLTAVALGAVAWRRAWPTRRRRLLQQVGTVAQ
LWIYPVKSCKGVPVSEAECTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCD
GDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEGRDCGEATAQWITSFLKSQPYRL
VHFEPHMRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEKKVKATNFRPN
IVISGCDVYAEDSWDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQC
DPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLLGQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VT66	1.000	1.000	4.338E-72	337	1.000	1.000	Q5VT66.pdb.gz	MARC1_HUMAN Mitochondrial amidoxime-reducing component 1 OS=Homo sapiens OX=9606 GN=MTARC1 PE=1 SV=1
2	AFDB:Q9CW42	0.884	0.876	1.768E-61	340	0.801	0.794	Q9CW42.pdb.gz	MARC1_MOUSE Mitochondrial amidoxime-reducing component 1 OS=Mus musculus OX=10090 GN=Mtarc1 PE=1 SV=2
3	PDB:6fw2A	0.842	0.639	1.041E-53	444	0.840	0.637	6fw2A.pdb.gz	Crystal structure of human mARC1 reveals its exceptional position among eukaryotic molybdenum enzymes.
4	AFDB:Q969Z3	0.836	0.841	1.513E-53	335	0.653	0.657	Q969Z3.pdb.gz	MARC2_HUMAN Mitochondrial amidoxime reducing component 2 OS=Homo sapiens OX=9606 GN=MTARC2 PE=1 SV=1
5	AFDB:Q922Q1	0.836	0.834	1.380E-52	338	0.605	0.604	Q922Q1.pdb.gz	MARC2_MOUSE Mitochondrial amidoxime reducing component 2 OS=Mus musculus OX=10090 GN=Mtarc2 PE=1 SV=1
6	AFDB:O45394	0.788	0.783	3.906E-33	339	0.312	0.310	O45394.pdb.gz	O45394_CAEEL MOSC domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F22B8.7 PE=1 SV=2
7	AFDB:O48588	0.746	0.813	4.303E-29	308	0.291	0.318	O48588.pdb.gz	O48588_ARATH Molybdenum cofactor sulfurase family protein OS=Arabidopsis thaliana OX=3702 GN=T19K24.17 PE=1 SV=1
8	AFDB:P75863	0.746	0.683	1.680E-27	369	0.267	0.244	P75863.pdb.gz	YCBX_ECOLI Uncharacterized protein YcbX OS=Escherichia coli (strain K12) OX=83333 GN=ycbX PE=1 SV=1
9	AFDB:Q9N0E7	0.706	0.279	3.263E-26	882	0.234	0.090	Q9N0E7.pdb.gz	MOCOS_BOVIN Molybdenum cofactor sulfurase OS=Bos taurus OX=9913 GN=MOCOS PE=2 SV=3
10	AFDB:Q96EN8	0.723	0.283	4.365E-26	888	0.217	0.082	Q96EN8.pdb.gz	MOCOS_HUMAN Molybdenum cofactor sulfurase OS=Homo sapiens OX=9606 GN=MOCOS PE=1 SV=2
11	AFDB:Q9VRA2	0.680	0.304	9.758E-24	781	0.211	0.091	Q9VRA2.pdb.gz	MOCOS_DROME Molybdenum cofactor sulfurase OS=Drosophila melanogaster OX=7227 GN=mal PE=1 SV=1
12	PDB:1o65A	0.252	0.372	5.416E-4	218	0.059	0.092	1o65A.pdb.gz
13	PDB:6q6hA	0.111	0.035	3.876E-1	1551	0.053	0.012	6q6hA.pdb.gz	Cyclin A2 degradation during the spindle assembly checkpoint requires multiple binding modes to the APC/C.
14	PDB:1kv9A	0.101	0.064	4.354E-1	664	0.039	0.020	1kv9A.pdb.gz	Structure at 1.9 A resolution of a quinohemoprotein alcohol dehydrogenase from Pseudomonas putida HK5.
15	PDB:1flgA	0.094	0.060	4.891E-1	582	0.033	0.019	1flgA.pdb.gz	X-ray structure of the quinoprotein ethanol dehydrogenase from Pseudomonas aeruginosa: basis of substrate specificity.
16	PDB:6rlbD	0.082	0.063	4.891E-1	446	0.083	0.063	6rlbD.pdb.gz
17	PDB:3n6rA	0.114	0.075	5.494E-1	591	0.068	0.039	3n6rA.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
18	PDB:1yiqA	0.062	0.041	5.823E-1	684	0.047	0.023	1yiqA.pdb.gz	Molecular cloning and structural analysis of quinohemoprotein alcohol dehydrogenase ADH-IIG from Pseudomonas putida HK5
19	PDB:7zu0A	0.072	0.031	6.172E-1	954	0.030	0.010	7zu0A.pdb.gz
20	PDB:3n6rG	0.114	0.070	6.934E-1	646	0.068	0.036	3n6rG.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5VT66	0.0	695	337	1.000	1.000	MARC1_HUMAN Mitochondrial amidoxime-reducing component 1 OS=Homo sapiens OX=9606 GN=MTARC1 PE=1 SV=1
2	H7BYZ9	3.41e-180	500	263	0.727	0.932	H7BYZ9_HUMAN Mitochondrial amidoxime reducing component 1 (Fragment) OS=Homo sapiens OX=9606 GN=MTARC1 PE=1 SV=1
3	Q9CW42	1.13e-178	499	340	0.792	0.785	MARC1_MOUSE Mitochondrial amidoxime-reducing component 1 OS=Mus musculus OX=10090 GN=Mtarc1 PE=1 SV=2
4	Q969Z3	2.64e-141	405	335	0.647	0.651	MARC2_HUMAN Mitochondrial amidoxime reducing component 2 OS=Homo sapiens OX=9606 GN=MTARC2 PE=1 SV=1
5	Q922Q1	5.97e-137	394	338	0.602	0.601	MARC2_MOUSE Mitochondrial amidoxime reducing component 2 OS=Mus musculus OX=10090 GN=Mtarc2 PE=1 SV=1
6	O45394	1.46e-50	173	339	0.303	0.301	O45394_CAEEL MOSC domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F22B8.7 PE=1 SV=2
7	O48588	1.49e-42	151	308	0.315	0.344	O48588_ARATH Molybdenum cofactor sulfurase family protein OS=Arabidopsis thaliana OX=3702 GN=T19K24.17 PE=1 SV=1
8	P75863	5.72e-36	135	369	0.276	0.252	YCBX_ECOLI Uncharacterized protein YcbX OS=Escherichia coli (strain K12) OX=83333 GN=ycbX PE=1 SV=1
9	Q9C5X8	8.64e-25	107	819	0.231	0.095	MOCOS_ARATH Molybdenum cofactor sulfurase OS=Arabidopsis thaliana OX=3702 GN=ABA3 PE=1 SV=1
10	Q9N0E7	6.35e-21	96.3	882	0.223	0.085	MOCOS_BOVIN Molybdenum cofactor sulfurase OS=Bos taurus OX=9913 GN=MOCOS PE=2 SV=3
11	Q96EN8	8.41e-21	95.9	888	0.184	0.070	MOCOS_HUMAN Molybdenum cofactor sulfurase OS=Homo sapiens OX=9606 GN=MOCOS PE=1 SV=2
12	Q9VRA2	3.20e-14	75.9	781	0.175	0.076	MOCOS_DROME Molybdenum cofactor sulfurase OS=Drosophila melanogaster OX=7227 GN=mal PE=1 SV=1
13	Q6P179	0.39	35.0	960	0.089	0.031	ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2 OS=Homo sapiens OX=9606 GN=ERAP2 PE=1 SV=2
14	Q47910	1.3	33.5	548	0.148	0.091	CDA_MYROD Calcium-transporting ATPase OS=Myroides odoratus OX=256 GN=cda PE=1 SV=2
15	Q10104	1.7	32.7	488	0.077	0.053	GLYM_SCHPO Serine hydroxymethyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=shm2 PE=3 SV=2
16	B7Z0X1	2.0	32.7	467	0.062	0.045	B7Z0X1_DROME Serine hydroxymethyltransferase OS=Drosophila melanogaster OX=7227 GN=Shmt PE=1 SV=1
17	Q9W457	2.6	32.3	537	0.062	0.039	Q9W457_DROME Serine hydroxymethyltransferase OS=Drosophila melanogaster OX=7227 GN=Shmt PE=1 SV=1
18	B5DEL3	3.2	32.3	1198	0.065	0.018	TTC17_RAT Tetratricopeptide repeat protein 17 OS=Rattus norvegicus OX=10116 GN=Ttc17 PE=1 SV=1
19	Q4QFK2	3.3	32.0	465	0.071	0.052	Q4QFK2_LEIMA Serine hydroxymethyltransferase OS=Leishmania major OX=5664 GN=SHMT-S PE=3 SV=1
20	Q5HYW2	3.3	32.3	1225	0.059	0.016	NHSL2_HUMAN NHS-like protein 2 OS=Homo sapiens OX=9606 GN=NHSL2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03473 MOSC	8.4e-31	118.3	MOSC domain
2	PF03476 MOSC_N	5.8e-32	121.5	MOSC N-terminal beta barrel domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355877

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308430	0.831	Cytochrome b5 type B
2	9606.ENSP00000354468	0.792	NADH-cytochrome b5 reductase 3
3	9606.ENSP00000377668	0.661	Sulfite oxidase, mitochondrial
4	9606.ENSP00000326305	0.657	Mitochondrial carnitine/acylcarnitine carrier protein
5	9606.ENSP00000281703	0.633	Glycosyltransferase 1 domain-containing protein 1
6	9606.ENSP00000264151	0.627	Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial
7	9606.ENSP00000355880	0.624	Mitochondrial amidoxime reducing component 2
8	9606.ENSP00000483570	0.613	Tyrosine-protein kinase BTK
9	9606.ENSP00000482502	0.601	S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase
10	9606.ENSP00000397082	0.549	Pulmonary surfactant-associated protein A1
11	9606.ENSP00000363832	0.527	Aldehyde oxidase
12	9606.ENSP00000361400	0.525	Pulmonary surfactant-associated protein A2
13	9606.ENSP00000260264	0.513	POU domain, class 2, transcription factor 3
14	9606.ENSP00000336817	0.503	Leucine zipper protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098809	1.000	nitrite reductase activity
GO:0043546	1.000	molybdopterin cofactor binding
GO:0008940	1.000	nitrate reductase activity
GO:0046914	1.000	transition metal ion binding
GO:0016662	0.998	oxidoreductase activity, acting on other nitrogenous compounds as donors, cytochrome as acceptor
GO:0030151	0.982	molybdenum ion binding
GO:0050421	0.500	nitrite reductase (NO-forming) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0008152	0.996	metabolic process
GO:2001057	0.994	reactive nitrogen species metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0071704	0.993	organic substance metabolic process
GO:1990748	0.987	cellular detoxification
GO:0006809	0.977	nitric oxide biosynthetic process
GO:1901698	0.974	response to nitrogen compound
GO:0044281	0.973	small molecule metabolic process
GO:0006082	0.956	organic acid metabolic process
GO:0043436	0.953	oxoacid metabolic process
GO:0006950	0.951	response to stress
GO:0033554	0.540	cellular response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031966	0.998	mitochondrial membrane
GO:0098588	0.941	bounding membrane of organelle
GO:0032991	0.928	protein-containing complex
GO:0019867	0.904	outer membrane
GO:0031968	0.878	organelle outer membrane
GO:0005741	0.865	mitochondrial outer membrane
GO:0070013	0.430	intracellular organelle lumen
GO:1902494	0.406	catalytic complex
GO:0012505	0.334	endomembrane system
GO:1990204	0.303	oxidoreductase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21068	1.000	A + H2O + nitrite = AH2 + nitrate
EC:1.7.99.4	1.000	1.9.6.1.
EC:1.7.2.-	0.998	With a cytochrome as acceptor.
RHEA:15233	0.500	Fe(III)-[cytochrome c] + H2O + nitric oxide = Fe(II)-[cytochrome c] + 2 H(+) + nitrite
EC:1.7.2.1	0.500	nitrite reductase (NO-forming).

[back to server]