StarFunc result for job id Q5VT97

User Input

>input (1194 residues)
MHDLPPDSGARRGGRGLADHSFPAGARAPGQPPSRGAAYRRACPRDGERGGGGRPRQQVS
PPRSPQREPRGGQLRTPRMRPSCSRSLESLRVGAKPPPFQRWPSDSWIRCGAHRDWDEPP
PRGGRMDGWSGDRARAAAPTGLQPPGCKDHGCSSGSPFRDPAGSSVIRSGKGDRQEGPSF
LRPPAVTVKKLQKWMYKGRLLSLGMKGRARGTAPKVTGTQAASPNVGALKVRENRVLSVP
PDQRITLTDLFENAYGSSMKGRELEELKDNIEFRGHKPLNSITVSKKRNWLYQSTLRPLN
LEEENKKCQDRSHLSISPVSLPKHQLSQSFLKSSKEYCTYVVCNATNSSLSKNCALDFNE
ENDADDEGEIWYNPIPEDDDLGISSALSFGEADSAVLKLPAVNLSMLSGSDLMKAERHTE
DSLCSSEHAGDIQTTRSNGMNPIHPAHSTEFVQQYKQKLGHKTQEGIMVEDSPMLKSPFA
GSGILAATNSTELGIMEPSSPNPSPVKKGSSINWSLPDKIKSPRTVRKLSMKMKKLPEFS
RKLSVKGTLNYINSPDNTPSLSKYNCREVHHTDILPSGNTTTAAKRNVISRYHLDTSVSS
QQSYQKKNSMSSKYSCKGGYLSDGDSPELTTKASKHGSENKFGKGKEIISNSCSKNEIDI
DAFRHYSFSDQPKCSQYISGLMSVHFYGAEDLKPPRIDSKDVFCAIQVDSVNKARTALLT
CRTTFLDMDHTFNIEIENAQHLKLVVFSWEPTPRKNRVCCHGTVVLPTLFRVTKTHQLAV
KLEPRGLIYVKVTLMEQWENSLHGLDINQEPIIFGVDIQKVVEKENIGLMVPLLIQKCIM
EIEKRGCQVVGLYRLCGSAAVKKELREAFERDSKAVGLCENQYPDINVITGVLKDYLREL
PSPLITKQLYEAVLDAMAKSPLKMSSNGCENDPGDSKYTVDLLDCLPEIEKATLKMLLDH
LKLVASYHEVNKMTCQNLAVCFGPVLLSQRQEPSTHNNRVFTDSEELASALDFKKHIEVL
HYLLQLWPVQRLTVKKSTDNLFPEQKSSLNYLRQKKERPHMLNLSGTDSSGVLRPRQNRL
DSPLSNRYAGDWSSCGENYFLNTKENLNDVDYDDVPSEDRKIGENYSKMDGPEVMIEQPI
PMSKECTFQTYLTMQTVESTVDRKNNLKDLQESIDTLIGNLERELNKNKLNMSF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VT97	1.000	1.000	0.000	1194	1.000	1.000	Q5VT97.pdb.gz	SYDE2_HUMAN Rho GTPase-activating protein SYDE2 OS=Homo sapiens OX=9606 GN=SYDE2 PE=1 SV=2
2	AFDB:Q9P227	0.152	0.123	8.874E-20	1491	0.152	0.121	Q9P227.pdb.gz	RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23 PE=1 SV=2
3	AFDB:X2JC00	0.154	0.132	1.076E-18	1404	0.154	0.131	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
4	AFDB:P34288	0.148	0.112	3.337E-15	1605	0.159	0.118	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
5	PDB:3cxlA	0.152	0.427	1.328E-12	402	0.059	0.177	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
6	PDB:1xa6A	0.150	0.425	4.497E-12	399	0.054	0.160	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
7	PDB:6r3vA	0.145	0.789	9.246E-12	198	0.044	0.268	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
8	PDB:5c2kA	0.137	0.401	3.215E-10	382	0.051	0.160	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
9	PDB:5jcpA	0.124	0.397	1.359E-9	361	0.040	0.133	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
10	PDB:1cjyA	0.107	0.189	8.925E-7	633	0.037	0.070	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
11	AFDB:O43432	0.066	0.055	2.711E-6	1585	0.121	0.091	O43432.pdb.gz	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2
12	PDB:4rj9A	0.089	0.569	4.710E-6	161	0.018	0.137	4rj9A.pdb.gz
13	PDB:6kz8A	0.091	0.136	4.710E-6	784	0.014	0.022	6kz8A.pdb.gz	Crystal structure of plant PLD alpha 1 reveals catalytic and regulatory mechanisms of eukaryotic phospholipase D.
14	PDB:5a52A	0.091	0.641	5.880E-6	154	0.012	0.091	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
15	PDB:5a50A	0.089	0.535	1.351E-5	165	0.015	0.109	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
16	AFDB:Q80XI3	0.052	0.048	8.436E-5	1579	0.125	0.094	Q80XI3.pdb.gz	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2
17	AFDB:Q57WC1	0.058	0.053	1.833E-4	1387	0.133	0.115	Q57WC1.pdb.gz	Q57WC1_TRYB2 Ancestral coatomer element 1 Sec16/Sec31 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.610 PE=3 SV=1
18	AFDB:A0A286Y917	0.076	0.078	2.419E-4	1171	0.105	0.107	A0A286Y917.pdb.gz	A0A286Y917_DANRE Anillin isoform X1 OS=Danio rerio OX=7955 GN=si:ch211-197n10.2 PE=1 SV=1
19	AFDB:Q8I3S3	0.046	0.034	2.703E-4	1894	0.124	0.078	Q8I3S3.pdb.gz	Q8I3S3_PLAF7 mRNA-binding protein PUF1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0518700 PE=4 SV=1
20	AFDB:Q6XK20	0.066	0.071	5.557E-4	1102	0.112	0.122	Q6XK20.pdb.gz	Q6XK20_DROME Bitesize isoform 1 OS=Drosophila melanogaster OX=7227 GN=btsz PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5VT97	0.0	2481	1194	1.000	1.000	SYDE2_HUMAN Rho GTPase-activating protein SYDE2 OS=Homo sapiens OX=9606 GN=SYDE2 PE=1 SV=2
2	Q6ZW31	4.12e-142	449	735	0.243	0.395	SYDE1_HUMAN Rho GTPase-activating protein SYDE1 OS=Homo sapiens OX=9606 GN=SYDE1 PE=1 SV=1
3	Q9DBZ9	2.66e-136	434	737	0.246	0.399	SYDE1_MOUSE Rho GTPase-activating protein SYDE1 OS=Mus musculus OX=10090 GN=Syde1 PE=1 SV=1
4	Q9V9S7	6.70e-71	263	1866	0.125	0.080	SYDE_DROME Rho GTPase-activating protein 100F OS=Drosophila melanogaster OX=7227 GN=RhoGAP100F PE=1 SV=2
5	Q86NH1	2.91e-39	161	987	0.090	0.109	SYD1_CAEEL Rho GTPase-activating protein syd-1 OS=Caenorhabditis elegans OX=6239 GN=syd-1 PE=2 SV=1
6	P11274	1.42e-33	143	1271	0.097	0.091	BCR_HUMAN Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR PE=1 SV=2
7	Q6PAJ1	1.66e-33	143	1270	0.102	0.096	BCR_MOUSE Breakpoint cluster region protein OS=Mus musculus OX=10090 GN=Bcr PE=1 SV=3
8	F1LXF1	3.31e-33	142	1270	0.101	0.095	BCR_RAT Breakpoint cluster region protein OS=Rattus norvegicus OX=10116 GN=Bcr PE=1 SV=4
9	Q5SSL4	1.61e-31	135	859	0.095	0.132	ABR_MOUSE Active breakpoint cluster region-related protein OS=Mus musculus OX=10090 GN=Abr PE=1 SV=1
10	A0A0G2JTR4	1.88e-31	135	859	0.095	0.132	ABR_RAT Active breakpoint cluster region-related protein OS=Rattus norvegicus OX=10116 GN=Abr PE=1 SV=2
11	Q12979	5.22e-31	134	859	0.095	0.133	ABR_HUMAN Active breakpoint cluster region-related protein OS=Homo sapiens OX=9606 GN=ABR PE=1 SV=2
12	X2JC00	7.75e-25	115	1404	0.082	0.070	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
13	X2J9V9	8.08e-25	115	1402	0.082	0.070	X2J9V9_DROME Rho GTPase activating protein at 1A, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
14	Q29QE1	8.15e-25	115	1403	0.082	0.070	Q29QE1_DROME GH15984p OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
15	Q9W4A9	5.72e-24	109	494	0.053	0.128	Q9W4A9_DROME Rho GTPase activating protein at 5A, isoform A OS=Drosophila melanogaster OX=7227 GN=RhoGAP5A PE=4 SV=1
16	Q1RLN5	6.66e-24	111	799	0.050	0.075	Q1RLN5_HUMAN ARHGAP12 protein OS=Homo sapiens OX=9606 GN=ARHGAP12 PE=1 SV=1
17	Q8IWW6	6.92e-24	111	846	0.050	0.071	RHG12_HUMAN Rho GTPase-activating protein 12 OS=Homo sapiens OX=9606 GN=ARHGAP12 PE=1 SV=1
18	Q8MSA6	1.87e-23	108	531	0.079	0.177	Q8MSA6_DROME LD45876p OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=2 SV=1
19	Q53QZ3	2.21e-23	107	475	0.054	0.135	RHG15_HUMAN Rho GTPase-activating protein 15 OS=Homo sapiens OX=9606 GN=ARHGAP15 PE=1 SV=2
20	Q6TLK4	7.83e-23	107	869	0.052	0.071	RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus OX=10116 GN=Arhgap27 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00620 RhoGAP	7.4e-38	141.2	RhoGAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340594

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000468263	0.647	ELKS/Rab6-interacting/CAST family member 1
2	9606.ENSP00000288221	0.642	ERC protein 2
3	9606.ENSP00000451648	0.604	Neurexin-3
4	9606.ENSP00000265459	0.572	Neurexin-2
5	9606.ENSP00000385142	0.572	Neurexin-1
6	9606.ENSP00000419417	0.556	UPF0690 protein C1orf52
7	9606.ENSP00000450337	0.545	Liprin-alpha-2
8	9606.ENSP00000358242	0.522	Arginine/serine-rich protein PNISR
9	9606.ENSP00000335614	0.520	Liprin-alpha-3
10	9606.ENSP00000253925	0.513	Liprin-alpha-1
11	9606.ENSP00000401335	0.507	Uncharacterized protein C16orf90
12	9606.ENSP00000328017	0.503	KRAB-A domain containing 2
13	9606.ENSP00000478767	0.503	Neurabin-2
14	9606.ENSP00000272198	0.502	Liprin-alpha-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005096	1.000	GTPase activator activity
GO:0005488	0.974	binding
GO:0005515	0.961	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.985	cellular process
GO:1902531	0.974	regulation of intracellular signal transduction
GO:0051056	0.958	regulation of small GTPase mediated signal transduction
GO:0048870	0.648	cell motility
GO:0016477	0.573	cell migration
GO:0050896	0.463	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.791	organelle
GO:0030054	0.739	cell junction
GO:0043229	0.701	intracellular organelle
GO:0071944	0.447	cell periphery
GO:0016020	0.393	membrane
GO:0043231	0.382	intracellular membrane-bounded organelle
GO:0043232	0.301	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]