StarFunc result for job id Q5VT99

User Input

>input (294 residues)
MRPRAPACAAAALGLCSLLLLLAPGHACPAGCACTDPHTVDCRDRGLPSVPDPFPLDVRK
LLVAGNRIQRIPEDFFIFYGDLVYLDFRNNSLRSLEEGTFSGSAKLVFLDLSYNNLTQLG
AGAFRSAGRLVKLSLANNNLVGVHEDAFETLESLQVLELNDNNLRSLSVAALAALPALRS
LRLDGNPWLCDCDFAHLFSWIQENASKLPKGLDEIQCSLPMESRRISLRELSEASFSECR
FSLSLTDLCIIIFSGVAVSIAAIISSFFLATVVQCLQRCAPNKDAEDEDEDKDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VT99	1.000	1.000	2.800E-50	294	1.000	1.000	Q5VT99.pdb.gz	LRC38_HUMAN Leucine-rich repeat-containing protein 38 OS=Homo sapiens OX=9606 GN=LRRC38 PE=1 SV=1
2	AFDB:Q6ZSA7	0.771	0.762	1.953E-18	298	0.347	0.342	Q6ZSA7.pdb.gz	LRC55_HUMAN Leucine-rich repeat-containing protein 55 OS=Homo sapiens OX=9606 GN=LRRC55 PE=1 SV=3
3	AFDB:Q8N7C0	0.782	0.739	8.499E-16	313	0.296	0.278	Q8N7C0.pdb.gz	LRC52_HUMAN Leucine-rich repeat-containing protein 52 OS=Homo sapiens OX=9606 GN=LRRC52 PE=1 SV=2
4	AFDB:Q5M8M9	0.731	0.690	9.931E-16	314	0.286	0.268	Q5M8M9.pdb.gz	LRC52_MOUSE Leucine-rich repeat-containing protein 52 OS=Mus musculus OX=10090 GN=Lrrc52 PE=1 SV=1
5	AFDB:Q6WRI0	0.599	0.079	3.831E-15	2623	0.259	0.029	Q6WRI0.pdb.gz	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
6	AFDB:A8BB30	0.607	0.421	5.511E-15	444	0.262	0.173	A8BB30.pdb.gz
7	AFDB:F1QA76	0.532	0.347	1.201E-14	457	0.282	0.182	F1QA76.pdb.gz
8	AFDB:Q2I0M4	0.710	0.631	1.478E-14	334	0.303	0.266	Q2I0M4.pdb.gz	LRC26_HUMAN Leucine-rich repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=LRRC26 PE=1 SV=2
9	AFDB:Q3V1M1	0.596	0.079	2.126E-14	2594	0.255	0.029	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
10	AFDB:Q6WRH9	0.543	0.070	7.019E-14	2597	0.248	0.028	Q6WRH9.pdb.gz	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
11	PDB:5y31B	0.454	0.283	3.900E-7	511	0.177	0.102	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
12	PDB:1xcdA	0.464	0.449	1.288E-6	305	0.177	0.170	1xcdA.pdb.gz
13	PDB:7wrqA	0.410	0.241	2.280E-6	566	0.221	0.115	7wrqA.pdb.gz
14	PDB:6gffI	0.315	0.195	5.805E-6	551	0.184	0.098	6gffI.pdb.gz
15	PDB:5yq5B	0.411	0.396	9.264E-6	306	0.146	0.141	5yq5B.pdb.gz
16	PDB:2ft3F	0.311	0.300	1.201E-5	305	0.177	0.170	2ft3F.pdb.gz
17	PDB:3b2dA	0.264	0.137	1.332E-5	601	0.190	0.093	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
18	PDB:7wv3A	0.562	0.256	2.240E-5	668	0.153	0.067	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
19	PDB:7lt9A	0.389	0.443	2.617E-5	251	0.156	0.183	7lt9A.pdb.gz	Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly.
20	PDB:5xjxC	0.321	0.269	8.203E-5	365	0.146	0.118	5xjxC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5VT99	0.0	588	294	1.000	1.000	LRC38_HUMAN Leucine-rich repeat-containing protein 38 OS=Homo sapiens OX=9606 GN=LRRC38 PE=1 SV=1
2	Q6ZSA7	5.77e-52	174	298	0.357	0.352	LRC55_HUMAN Leucine-rich repeat-containing protein 55 OS=Homo sapiens OX=9606 GN=LRRC55 PE=1 SV=3
3	Q8N7C0	2.88e-35	131	313	0.299	0.281	LRC52_HUMAN Leucine-rich repeat-containing protein 52 OS=Homo sapiens OX=9606 GN=LRRC52 PE=1 SV=2
4	Q5M8M9	4.00e-33	125	314	0.286	0.268	LRC52_MOUSE Leucine-rich repeat-containing protein 52 OS=Mus musculus OX=10090 GN=Lrrc52 PE=1 SV=1
5	Q2I0M4	9.22e-31	119	334	0.296	0.260	LRC26_HUMAN Leucine-rich repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=LRRC26 PE=1 SV=2
6	O94813	2.36e-28	117	1529	0.276	0.053	SLIT2_HUMAN Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=SLIT2 PE=1 SV=1
7	O88279	2.67e-28	116	1531	0.262	0.050	SLIT1_RAT Slit homolog 1 protein OS=Rattus norvegicus OX=10116 GN=Slit1 PE=1 SV=1
8	Q9WVC1	4.88e-28	115	766	0.269	0.103	SLIT2_RAT Slit homolog 2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Slit2 PE=1 SV=3
9	O75093	7.73e-28	115	1534	0.259	0.050	SLIT1_HUMAN Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=SLIT1 PE=1 SV=4
10	Q80TR4	1.13e-27	115	1531	0.262	0.050	SLIT1_MOUSE Slit homolog 1 protein OS=Mus musculus OX=10090 GN=Slit1 PE=1 SV=2
11	Q9R1B9	3.24e-27	113	1521	0.269	0.052	SLIT2_MOUSE Slit homolog 2 protein OS=Mus musculus OX=10090 GN=Slit2 PE=2 SV=2
12	Q9DE36	6.71e-27	112	1512	0.255	0.050	Q9DE36_DANRE Slit homolog 2 protein precursor OS=Danio rerio OX=7955 GN=slit2 PE=1 SV=1
13	Q3S2J2	7.67e-27	112	1524	0.255	0.049	Q3S2J2_DANRE Slit homolog 1 protein precursor OS=Danio rerio OX=7955 GN=slit1a PE=1 SV=1
14	Q3V1M1	8.04e-27	112	2594	0.265	0.030	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
15	Q6WRH9	2.65e-26	110	2597	0.269	0.030	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
16	Q6WRI0	1.72e-25	108	2623	0.272	0.030	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
17	D2XV92	3.69e-25	107	1513	0.252	0.049	D2XV92_CHICK SLIT1 (Fragment) OS=Gallus gallus OX=9031 GN=SLIT1 PE=2 SV=1
18	O88280	1.54e-24	105	1523	0.245	0.047	SLIT3_RAT Slit homolog 3 protein OS=Rattus norvegicus OX=10116 GN=Slit3 PE=2 SV=1
19	P24014	1.82e-24	105	1504	0.259	0.051	SLIT_DROME Protein slit OS=Drosophila melanogaster OX=7227 GN=sli PE=1 SV=2
20	F1RCV3	4.31e-24	104	1516	0.238	0.046	F1RCV3_DANRE Slit homolog 3 (Drosophila) OS=Danio rerio OX=7955 GN=zgc:111911 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01462 LRRNT	0.23	22.4	Leucine rich repeat N-terminal domain
2	PF00560 LRR_1	0.0065	27.6	Leucine Rich Repeat
3	PF07725 LRR_3	5.7	18.1	Leucine Rich Repeat
4	PF12799 LRR_4	1.9e-08	45.7	Leucine Rich repeats (2 copies)
5	PF13306 LRR_5	0.00027	32.3	BspA type Leucine rich repeat region (6 copies)
6	PF13516 LRR_6	24	16.4	Leucine Rich repeat
7	PF13855 LRR_8	2.9e-26	102.3	Leucine rich repeat
8	PF14580 LRR_9	0.017	26.2	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365253

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000319370	0.837	Calcium-activated potassium channel subunit beta-3
2	9606.ENSP00000382770	0.742	Potassium channel subfamily U member 1
3	9606.ENSP00000286628	0.713	Calcium-activated potassium channel subunit alpha-1
4	9606.ENSP00000258111	0.702	Calcium-activated potassium channel subunit beta-4
5	9606.ENSP00000355166	0.632	Leucine-rich repeat-containing protein 10
6	9606.ENSP00000274629	0.626	Calcium-activated potassium channel subunit beta-1
7	9606.ENSP00000310788	0.578	Olfactory receptor 5J2
8	9606.ENSP00000362792	0.561	Olfactory receptor 1N2
9	9606.ENSP00000396593	0.536	Dystrotelin
10	9606.ENSP00000351770	0.534	Forkhead-associated domain-containing protein 1
11	9606.ENSP00000359401	0.518	Uncharacterized protein C1orf146
12	9606.ENSP00000313699	0.513	Hephaestin-like protein 1
13	9606.ENSP00000299045	0.506	T-complex protein 11-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0015459	0.998	potassium channel regulator activity
GO:0044325	0.991	transmembrane transporter binding
GO:0099103	0.991	channel activator activity
GO:0022839	0.311	monoatomic ion gated channel activity
GO:0005261	0.306	monoatomic cation channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0009987	0.981	cellular process
GO:0006813	0.877	potassium ion transport
GO:0048518	0.758	positive regulation of biological process
GO:0048522	0.701	positive regulation of cellular process
GO:0043266	0.668	regulation of potassium ion transport
GO:1904062	0.486	regulation of monoatomic cation transmembrane transport
GO:0034764	0.381	positive regulation of transmembrane transport
GO:1904064	0.355	positive regulation of cation transmembrane transport
GO:0043268	0.354	positive regulation of potassium ion transport
GO:1901379	0.353	regulation of potassium ion transmembrane transport
GO:2001259	0.353	positive regulation of cation channel activity
GO:0071805	0.332	potassium ion transmembrane transport
GO:1901018	0.332	positive regulation of potassium ion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0008076	0.973	voltage-gated potassium channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]