StarFunc result for job id Q5VTB9

User Input

>input (566 residues)
MDLHRAAFKMENSSYLPNPLASPALMVLASTAEASRDASIPCQQPRPFGVPVSVDKDVHI
PFTNGSYTFASMYHRQGGVPGTFANRDFPPSLLHLHPQFAPPNLDCTPISMLNHSGVGAF
RPFASTEDRESYQSAFTPAKRLKNCHDTESPHLRFSDADGKEYDFGTQLPSSSPGSLKVD
DTGKKIFAVSGLISDREASSSPEDRNDRCKKKAAALFDSQAPICPICQVLLRPSELQEHM
EQELEQLAQLPSSKNSLLKDAMAPGTPKSLLLSASIKREGESPTASPHSSATDDLHHSDR
YQTFLRVRANRQTRLNARIGKMKRRKQDEGQREGSCMAEDDAVDIEHENNNRFEEYEWCG
QKRIRATTLLEGGFRGSGFIMCSGKENPDSDADLDVDGDDTLEYGKPQYTEADVIPCTGE
EPGEAKEREALRGAVLNGGPPSTRITPEFSKWASDEMPSTSNGESSKQEAMQKTCKNSDI
EKITEDSAVTTFEALKARVRELERQLSRGDRYKCLICMDSYSMPLTSIQCWHVHCEECWL
RTLGAKKLCPQCNTITAPGDLRRIYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VTB9	1.000	1.000	9.991E-94	566	1.000	1.000	Q5VTB9.pdb.gz	RN220_HUMAN E3 ubiquitin-protein ligase RNF220 OS=Homo sapiens OX=9606 GN=RNF220 PE=1 SV=1
2	PDB:4r8pL	0.097	0.212	1.828E-3	254	0.028	0.063	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
3	AFDB:Q7JR75	0.063	0.046	1.945E-3	824	0.124	0.085	Q7JR75.pdb.gz	Q7JR75_DROME CAP, isoform C OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
4	AFDB:P51125	0.061	0.048	2.078E-3	788	0.129	0.093	P51125.pdb.gz	ICAL_MOUSE Calpastatin OS=Mus musculus OX=10090 GN=Cast PE=1 SV=2
5	AFDB:A0A1D9BZF0	0.070	0.077	2.534E-3	507	0.108	0.120	A0A1D9BZF0.pdb.gz	GCNA_MOUSE Germ cell nuclear acidic protein OS=Mus musculus OX=10090 GN=Gcna PE=1 SV=1
6	AFDB:P51514	0.058	0.054	2.534E-3	707	0.150	0.120	P51514.pdb.gz	HTF4_RAT Transcription factor 12 OS=Rattus norvegicus OX=10116 GN=Tcf12 PE=1 SV=1
7	PDB:5gm6a	0.088	0.392	4.316E-3	123	0.023	0.106	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
8	AFDB:O74953	0.084	0.073	5.600E-3	699	0.131	0.106	O74953.pdb.gz	YJC7_SCHPO Uncharacterized protein C736.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC736.07c PE=4 SV=1
9	AFDB:Q6ZBQ2	0.049	0.053	6.391E-3	508	0.129	0.144	Q6ZBQ2.pdb.gz	Q6ZBQ2_ORYSJ BHLH transcription factor OS=Oryza sativa subsp. japonica OX=39947 GN=Os08g0490000 PE=1 SV=1
10	AFDB:A0A024R5T1	0.092	0.080	6.828E-3	682	0.143	0.119	A0A024R5T1.pdb.gz
11	AFDB:P49687	0.059	0.031	6.828E-3	1317	0.122	0.052	P49687.pdb.gz	NU145_YEAST Nucleoporin NUP145 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP145 PE=1 SV=1
12	AFDB:Q9I7V0	0.071	0.040	7.294E-3	1241	0.120	0.055	Q9I7V0.pdb.gz	Q9I7V0_DROME Mid1, isoform A OS=Drosophila melanogaster OX=7227 GN=Mid1 PE=2 SV=3
13	PDB:5dkaA	0.084	0.461	2.108E-2	96	0.023	0.135	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
14	PDB:7qcdC	0.091	0.190	7.905E-2	267	0.028	0.060	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
15	PDB:1b71A	0.060	0.161	9.638E-2	191	0.025	0.073	1b71A.pdb.gz	Alternative metal-binding sites in rubrerythrin.
16	PDB:7jzvA	0.106	0.224	1.433E-1	253	0.034	0.075	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
17	PDB:3m62A	0.104	0.064	6.551E-1	955	0.016	0.009	3m62A.pdb.gz
18	PDB:5gmkq	0.093	0.134	7.476E-1	387	0.012	0.018	5gmkq.pdb.gz	Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
19	PDB:2c2lA	0.096	0.183	7.987E-1	281	0.018	0.036	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
20	PDB:3jb9U	0.093	0.121	7.987E-1	430	0.014	0.019	3jb9U.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5VTB9	0.0	1180	566	1.000	1.000	RN220_HUMAN E3 ubiquitin-protein ligase RNF220 OS=Homo sapiens OX=9606 GN=RNF220 PE=1 SV=1
2	Q6PDX6	0.0	1161	566	0.979	0.979	RN220_MOUSE E3 ubiquitin-protein ligase Rnf220 OS=Mus musculus OX=10090 GN=Rnf220 PE=1 SV=1
3	Q5F338	6.92e-178	506	305	0.452	0.839	Q5F338_CHICK Uncharacterized protein OS=Gallus gallus OX=9031 GN=RCJMB04_37m20 PE=2 SV=1
4	Q9VNJ0	3.05e-05	48.5	319	0.046	0.082	Q9VNJ0_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=dgrn PE=1 SV=1
5	Q8I0J6	3.10e-05	48.5	312	0.046	0.083	Q8I0J6_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=dgrn PE=2 SV=1
6	A0A0B4LHT4	5.32e-05	47.0	205	0.046	0.127	A0A0B4LHT4_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=dgrn PE=4 SV=1
7	Q6LFN2	0.001	43.9	1103	0.032	0.016	ZNRF1_PLAF7 RING finger protein PFF0165c OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PFF0165c PE=1 SV=1
8	Q3U827	0.002	43.5	592	0.042	0.041	RN180_MOUSE E3 ubiquitin-protein ligase RNF180 OS=Mus musculus OX=10090 GN=Rnf180 PE=1 SV=2
9	Q9SFV0	0.005	40.4	182	0.028	0.088	Q9SFV0_ARATH Putative RING zinc finger protein OS=Arabidopsis thaliana OX=3702 GN=T1B9.13 PE=1 SV=1
10	Q5ZIP0	0.006	41.6	501	0.032	0.036	Q5ZIP0_CHICK RING-type E3 ubiquitin transferase OS=Gallus gallus OX=9031 GN=RCJMB04_24j13 PE=2 SV=1
11	Q8TDB6	0.008	41.6	740	0.034	0.026	DTX3L_HUMAN E3 ubiquitin-protein ligase DTX3L OS=Homo sapiens OX=9606 GN=DTX3L PE=1 SV=1
12	P87176	0.016	40.0	269	0.035	0.074	SLX8_SCHPO E3 ubiquitin-protein ligase complex slx8-rfp subunit slx8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=slx8 PE=1 SV=1
13	Q557I6	0.017	40.4	552	0.034	0.034	Q557I6_DICDI RING-type E3 ubiquitin transferase OS=Dictyostelium discoideum OX=44689 GN=mip1-2 PE=4 SV=1
14	Q9QXK2	0.026	39.7	509	0.030	0.033	RAD18_MOUSE E3 ubiquitin-protein ligase RAD18 OS=Mus musculus OX=10090 GN=Rad18 PE=1 SV=2
15	Q14527	0.033	39.7	1009	0.035	0.020	HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens OX=9606 GN=HLTF PE=1 SV=2
16	Q9VXP1	0.033	38.9	277	0.039	0.079	Q9VXP1_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=sordd1 PE=1 SV=1
17	A0A0C4DGA6	0.034	39.7	1008	0.035	0.020	A0A0C4DGA6_HUMAN Helicase like transcription factor OS=Homo sapiens OX=9606 GN=HLTF PE=1 SV=1
18	P40072	0.039	38.5	274	0.049	0.102	SLX8_YEAST E3 ubiquitin-protein ligase complex SLX5-SLX8 subunit SLX8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLX8 PE=1 SV=1
19	Q8IR26	0.040	38.5	283	0.039	0.078	Q8IR26_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=sordd2 PE=2 SV=2
20	Q9NS91	0.053	38.9	495	0.028	0.032	RAD18_HUMAN E3 ubiquitin-protein ligase RAD18 OS=Homo sapiens OX=9606 GN=RAD18 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02945 Endonuclease_7	16	16.9	Recombination endonuclease VII
2	PF04508 Pox_A_type_inc	1.2e+02	13.9	Viral A-type inclusion protein repeat
3	PF12230 PRP21_like_P	4.3e+02	12.2	Pre-mRNA splicing factor PRP21 like protein
4	PF15926 RNF220	1.8e-71	252.3	E3 ubiquitin-protein ligase RNF220
5	PF00097 zf-C3HC4	4	18.7	Zinc finger, C3HC4 type (RING finger)
6	PF13923 zf-C3HC4_2	4.3e-11	53.8	Zinc finger, C3HC4 type (RING finger)
7	PF13920 zf-C3HC4_3	0.19	22.9	Zinc finger, C3HC4 type (RING finger)
8	PF13248 zf-ribbon_3	49	14.8	zinc-ribbon domain
9	PF13639 zf-RING_2	7.5	18.3	Ring finger domain
10	PF14634 zf-RING_5	0.49	21.7	zinc-RING finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347548

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363972	0.862	Zinc finger C4H2 domain-containing protein
2	9606.ENSP00000361331	0.784	ERI1 exoribonuclease family member 3
3	9606.ENSP00000343535	0.761	Ubiquitin carboxyl-terminal hydrolase 7
4	9606.ENSP00000361311	0.747	Transmembrane protein 53
5	9606.ENSP00000361392	0.742	Coiled-coil domain containing 24
6	9606.ENSP00000361363	0.724	DNA methyltransferase 1-associated protein 1
7	9606.ENSP00000414055	0.701	Nuclear receptor-binding protein 2
8	9606.ENSP00000310696	0.691	Beta-1,4-galactosyltransferase 2
9	9606.ENSP00000484472	0.675	Epiplakin
10	9606.ENSP00000369131	0.655	Paired amphipathic helix protein Sin3b
11	9606.ENSP00000319651	0.644	Doublesex- and mab-3-related transcription factor A1
12	9606.ENSP00000434359	0.643	Poly(U)-binding-splicing factor PUF60
13	9606.ENSP00000353791	0.610	Sodium- and chloride-dependent glycine transporter 1
14	9606.ENSP00000331298	0.545	UBA-like domain-containing protein 2
15	9606.ENSP00000364502	0.541	Transmembrane protein 255B
16	9606.ENSP00000319006	0.530	Coiled-coil domain containing 71
17	9606.ENSP00000354560	0.519	Kinesin-associated protein 3
18	9606.ENSP00000440915	0.514	Mitochondrial ribonuclease P catalytic subunit
19	9606.ENSP00000348959	0.512	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB
20	9606.ENSP00000295704	0.509	E3 ubiquitin-protein ligase RNF25

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008013	0.982	beta-catenin binding
GO:0003824	0.943	catalytic activity
GO:0016740	0.825	transferase activity
GO:0140096	0.781	catalytic activity, acting on a protein
GO:0004842	0.627	ubiquitin-protein transferase activity
GO:0061630	0.470	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.990	regulation of cellular process
GO:0044238	0.989	primary metabolic process
GO:0071704	0.987	organic substance metabolic process
GO:0019538	0.977	protein metabolic process
GO:0043412	0.976	macromolecule modification
GO:0070647	0.974	protein modification by small protein conjugation or removal
GO:0016567	0.961	protein ubiquitination
GO:0006513	0.953	protein monoubiquitination
GO:0019222	0.952	regulation of metabolic process
GO:0060255	0.943	regulation of macromolecule metabolic process
GO:0009987	0.942	cellular process
GO:0065009	0.940	regulation of molecular function
GO:0009889	0.935	regulation of biosynthetic process
GO:0051090	0.928	regulation of DNA-binding transcription factor activity
GO:2000677	0.927	regulation of transcription regulatory region DNA binding
GO:0051091	0.917	positive regulation of DNA-binding transcription factor activity
GO:0048518	0.720	positive regulation of biological process
GO:0048522	0.712	positive regulation of cellular process
GO:0048583	0.568	regulation of response to stimulus
GO:0032502	0.419	developmental process
GO:0032501	0.392	multicellular organismal process
GO:0009966	0.384	regulation of signal transduction
GO:0007399	0.365	nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.997	nuclear lumen
GO:0005737	0.993	cytoplasm
GO:0032991	0.983	protein-containing complex
GO:0005654	0.697	nucleoplasm
GO:0034399	0.417	nuclear periphery
GO:0005652	0.366	nuclear lamina
GO:0016363	0.347	nuclear matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.825	Transferases.

[back to server]