StarFunc result for job id Q5VTD9

User Input

>input (330 residues)
MPRSFLVKSKKAHTYHQPRVQEDEPLWPPALTPVPRDQAPSNSPVLSTLFPNQCLDWTNL
KREPELEQDQNLARMAPAPEGPIVLSRPQDGDSPLSDSPPFYKPSFSWDTLATTYGHSYR
QAPSTMQSAFLEHSVSLYGSPLVPSTEPALDFSLRYSPGMDAYHCVKCNKVFSTPHGLEV
HVRRSHSGTRPFACDICGKTFGHAVSLEQHTHVHSQERSFECRMCGKAFKRSSTLSTHLL
IHSDTRPYPCQFCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTG
FKPFSCELCTKGFQRKVDLRRHRESQHNLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VTD9	1.000	1.000	7.414E-57	330	1.000	1.000	Q5VTD9.pdb.gz	GFI1B_HUMAN Zinc finger protein Gfi-1b OS=Homo sapiens OX=9606 GN=GFI1B PE=1 SV=1
2	AFDB:A0A1B0GTD0	0.422	0.391	9.716E-50	362	0.997	0.909	A0A1B0GTD0.pdb.gz	A0A1B0GTD0_HUMAN Growth factor independent 1B transcriptional repressor OS=Homo sapiens OX=9606 GN=GFI1B PE=1 SV=1
3	AFDB:O70237	0.576	0.576	2.564E-45	330	0.845	0.845	O70237.pdb.gz	GFI1B_MOUSE Zinc finger protein Gfi-1b OS=Mus musculus OX=10090 GN=Gfi1b PE=1 SV=1
4	AFDB:Q8TBZ5	0.453	0.283	1.129E-21	544	0.267	0.162	Q8TBZ5.pdb.gz	ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens OX=9606 GN=ZNF502 PE=1 SV=1
5	AFDB:Q12901	0.450	0.286	1.639E-21	538	0.258	0.158	Q12901.pdb.gz	ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens OX=9606 GN=ZNF155 PE=1 SV=4
6	AFDB:Q9UEG4	0.492	0.199	2.531E-21	869	0.309	0.117	Q9UEG4.pdb.gz	ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2
7	AFDB:Q96HQ0	0.447	0.301	3.245E-21	510	0.267	0.173	Q96HQ0.pdb.gz	ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens OX=9606 GN=ZNF419 PE=1 SV=2
8	AFDB:P10073	0.492	0.336	5.331E-21	491	0.297	0.200	P10073.pdb.gz	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
9	AFDB:P17098	0.470	0.280	7.737E-21	575	0.291	0.167	P17098.pdb.gz	ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens OX=9606 GN=ZNF8 PE=1 SV=2
10	AFDB:Q9NQZ8	0.486	0.332	8.760E-21	489	0.276	0.186	Q9NQZ8.pdb.gz	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
11	PDB:3w5kB	0.127	0.260	1.262E-4	110	0.115	0.345	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7ad8D	0.077	0.085	1.397	280	0.076	0.089	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
13	PDB:5gm6a	0.054	0.117	2.157	123	0.070	0.187	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:7pmkQ	0.057	0.034	2.295	766	0.073	0.031	7pmkQ.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
15	PDB:5n5yI	0.051	0.141	3.331	99	0.036	0.121	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
16	PDB:4kfzB	0.084	0.136	3.544	148	0.088	0.196	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
17	PDB:4c2mI	0.049	0.112	3.771	124	0.058	0.153	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
18	PDB:1zvfA	0.069	0.118	4.013	176	0.021	0.040	1zvfA.pdb.gz
19	PDB:6cp37	0.072	0.099	4.270	171	0.039	0.076	6cp37.pdb.gz	High-resolution cryo-EM analysis of the yeast ATP synthase in a lipid membrane.
20	PDB:6t9iI	0.095	0.150	4.270	173	0.058	0.110	6t9iI.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R8F3	0.0	671	352	1.000	0.938	A0A024R8F3_HUMAN Growth factor independent 1B (Potential regulator of CDKN1A, translocated in CML), isoform CRA_a OS=Homo sapiens OX=9606 GN=GFI1B PE=1 SV=1
2	A0A1B0GTD0	0.0	668	362	1.000	0.912	A0A1B0GTD0_HUMAN Growth factor independent 1B transcriptional repressor OS=Homo sapiens OX=9606 GN=GFI1B PE=1 SV=1
3	O70237	0.0	588	330	0.852	0.852	GFI1B_MOUSE Zinc finger protein Gfi-1b OS=Mus musculus OX=10090 GN=Gfi1b PE=1 SV=1
4	Q5VTD9	0.0	685	330	1.000	1.000	GFI1B_HUMAN Zinc finger protein Gfi-1b OS=Homo sapiens OX=9606 GN=GFI1B PE=1 SV=1
5	E7FBX7	3.64e-135	389	334	0.642	0.635	E7FBX7_DANRE Growth factor-independent 1B transcription repressor OS=Danio rerio OX=7955 GN=si:ch211-231o6.2 PE=4 SV=1
6	Q501T1	3.43e-112	332	385	0.591	0.506	Q501T1_DANRE Gfi1.1 protein OS=Danio rerio OX=7955 GN=gfi1.1 PE=2 SV=1
7	Q7SZV1	5.59e-111	330	396	0.461	0.384	Q7SZV1_DANRE Growth factor independent 1 OS=Danio rerio OX=7955 GN=gfi1.2 PE=2 SV=1
8	Q07120	1.88e-110	329	423	0.458	0.357	GFI1_RAT Zinc finger protein Gfi-1 OS=Rattus norvegicus OX=10116 GN=Gfi1 PE=1 SV=1
9	P70338	6.58e-110	328	423	0.473	0.369	GFI1_MOUSE Zinc finger protein Gfi-1 OS=Mus musculus OX=10090 GN=Gfi1 PE=1 SV=2
10	Q99684	2.22e-109	327	422	0.458	0.358	GFI1_HUMAN Zinc finger protein Gfi-1 OS=Homo sapiens OX=9606 GN=GFI1 PE=1 SV=2
11	G5EDE1	1.17e-73	232	336	0.318	0.312	GFI1H_CAEEL Zinc finger protein GFI1 homolog pag-3 OS=Caenorhabditis elegans OX=6239 GN=pag-3 PE=1 SV=1
12	Q9N658	4.20e-63	211	541	0.285	0.174	GFI1_DROME Zinc finger protein sens OS=Drosophila melanogaster OX=7227 GN=sens PE=1 SV=1
13	Q9ESP5	2.46e-47	167	455	0.236	0.171	FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus OX=10090 GN=Fezf2 PE=1 SV=1
14	Q804Q5	1.66e-46	164	430	0.236	0.181	FEZF2_DANRE Fez family zinc finger protein 2 OS=Danio rerio OX=7955 GN=fezf2 PE=1 SV=2
15	Q9VQ56	2.44e-46	167	611	0.227	0.123	ERM_DROME Fez family zinc finger protein erm OS=Drosophila melanogaster OX=7227 GN=erm PE=1 SV=2
16	M9PBS1	2.91e-46	167	603	0.227	0.124	M9PBS1_DROME Earmuff, isoform B OS=Drosophila melanogaster OX=7227 GN=erm PE=4 SV=1
17	A0PJY2	2.97e-46	165	475	0.267	0.185	FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens OX=9606 GN=FEZF1 PE=1 SV=1
18	Q0VDQ9	3.27e-46	165	475	0.267	0.185	FEZF1_MOUSE Fez family zinc finger protein 1 OS=Mus musculus OX=10090 GN=Fezf1 PE=2 SV=1
19	M9PB02	3.31e-46	167	654	0.227	0.115	M9PB02_DROME Earmuff, isoform C OS=Drosophila melanogaster OX=7227 GN=erm PE=4 SV=1
20	A0A0R4YI50	4.41e-46	168	698	0.227	0.107	A0A0R4YI50_DROME Earmuff, isoform D OS=Drosophila melanogaster OX=7227 GN=erm PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01363 FYVE	1.1e+02	14.4	FYVE zinc finger
2	PF09237 GAGA	72	14.8	GAGA factor
3	PF01155 HypA	3.3e+02	12.7	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
4	PF14446 Prok-RING_1	4.4e+02	12.2	Prokaryotic RING finger family 1
5	PF01428 zf-AN1	5.5e+02	12.1	AN1-like Zinc finger
6	PF02892 zf-BED	1.6	20.1	BED zinc finger
7	PF00096 zf-C2H2	7.1e-24	94.0	Zinc finger, C2H2 type
8	PF18868 zf-C2H2_3rep	4	19.6	Zinc finger C2H2-type, 3 repeats
9	PF13894 zf-C2H2_4	1.3e-16	70.9	C2H2-type zinc finger
10	PF13912 zf-C2H2_6	4.2e-05	34.7	C2H2-type zinc finger
11	PF12171 zf-C2H2_jaz	3.9e-10	51.0	Zinc-finger double-stranded RNA-binding
12	PF05605 zf-Di19	24	16.6	Drought induced 19 protein (Di19), zinc-binding
13	PF13465 zf-H2C2_2	7.5e-25	97.4	Zinc-finger double domain
14	PF12874 zf-met	0.0079	27.8	Zinc-finger of C2H2 type
15	PF18439 zf_UBZ	1.4e+02	13.5	Ubiquitin-Binding Zinc Finger
16	PF17032 zinc_ribbon_15	47	16.1	zinc-ribbon family
17	PF09723 Zn-ribbon_8	3.1	19.3	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344782

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383042	0.993	Lysine-specific histone demethylase 1A
2	9606.ENSP00000262241	0.959	REST corepressor 1
3	9606.ENSP00000365858	0.917	Erythroid transcription factor
4	9606.ENSP00000294339	0.829	T-cell acute lymphocytic leukemia protein 1
5	9606.ENSP00000345681	0.785	Endothelial transcription factor GATA-2
6	9606.ENSP00000251268	0.752	Multiple epidermal growth factor-like domains protein 8
7	9606.ENSP00000268679	0.749	Protein CBFA2T3
8	9606.ENSP00000301459	0.746	REST corepressor 2
9	9606.ENSP00000257818	0.695	Rhombotin-2
10	9606.ENSP00000272369	0.692	Homeobox protein Meis1
11	9606.ENSP00000264824	0.691	Protein lyl-1
12	9606.ENSP00000430432	0.686	Histone deacetylase 2
13	9606.ENSP00000360829	0.684	Belongs to the glycosyltransferase 6 family
14	9606.ENSP00000262965	0.680	Transcription factor E2-alpha
15	9606.ENSP00000227163	0.661	Transcription factor PU.1
16	9606.ENSP00000413929	0.641	REST corepressor 3
17	9606.ENSP00000361180	0.633	General transcription factor 3C polypeptide 5
18	9606.ENSP00000259371	0.629	Disabled homolog 2-interacting protein
19	9606.ENSP00000364678	0.621	Histone-lysine N-methyltransferase EHMT2
20	9606.ENSP00000362649	0.617	Histone deacetylase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003690	0.967	double-stranded DNA binding
GO:1990837	0.962	sequence-specific double-stranded DNA binding
GO:0008134	0.874	transcription factor binding
GO:0140110	0.819	transcription regulator activity
GO:0003700	0.806	DNA-binding transcription factor activity
GO:0000976	0.788	transcription cis-regulatory region binding
GO:0000981	0.735	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.669	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0140297	0.546	DNA-binding transcription factor binding
GO:0000987	0.411	cis-regulatory region sequence-specific DNA binding
GO:0001217	0.362	DNA-binding transcription repressor activity
GO:0001227	0.316	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0031326	0.989	regulation of cellular biosynthetic process
GO:0019219	0.986	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.978	regulation of macromolecule metabolic process
GO:0010468	0.974	regulation of gene expression
GO:0051252	0.973	regulation of RNA metabolic process
GO:0010556	0.959	regulation of macromolecule biosynthetic process
GO:0006355	0.931	regulation of DNA-templated transcription
GO:0048523	0.898	negative regulation of cellular process
GO:0048518	0.888	positive regulation of biological process
GO:0009987	0.882	cellular process
GO:0010605	0.859	negative regulation of macromolecule metabolic process
GO:0051172	0.834	negative regulation of nitrogen compound metabolic process
GO:0031324	0.834	negative regulation of cellular metabolic process
GO:0048522	0.826	positive regulation of cellular process
GO:0045934	0.768	negative regulation of nucleobase-containing compound metabolic process
GO:0031327	0.749	negative regulation of cellular biosynthetic process
GO:1902679	0.736	negative regulation of RNA biosynthetic process
GO:0045892	0.667	negative regulation of DNA-templated transcription
GO:0006357	0.664	regulation of transcription by RNA polymerase II
GO:0050793	0.545	regulation of developmental process
GO:0051726	0.540	regulation of cell cycle
GO:0009893	0.505	positive regulation of metabolic process
GO:0000122	0.496	negative regulation of transcription by RNA polymerase II
GO:0048856	0.491	anatomical structure development
GO:0051239	0.480	regulation of multicellular organismal process
GO:0010604	0.466	positive regulation of macromolecule metabolic process
GO:0045786	0.459	negative regulation of cell cycle
GO:0032501	0.455	multicellular organismal process
GO:1902806	0.453	regulation of cell cycle G1/S phase transition
GO:0045595	0.439	regulation of cell differentiation
GO:0051173	0.429	positive regulation of nitrogen compound metabolic process
GO:0050896	0.427	response to stimulus
GO:0031325	0.360	positive regulation of cellular metabolic process
GO:1903508	0.345	positive regulation of nucleic acid-templated transcription
GO:0045893	0.344	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005886	0.954	plasma membrane
GO:0032991	0.876	protein-containing complex
GO:0005737	0.722	cytoplasm
GO:0005667	0.630	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]