StarFunc result for job id Q5VTE6

User Input

>input (544 residues)
MEAWRCVRKGYGHCVVGRGRYPMFPHHSRSLGRDWTTPWENLQRCCWNRHISSCMRWPGH
YSRAPYPYFSSRHFSLNWRPPCLFESRTQFQYCNWRPDNLSQTSLIHLSSYVMNAEGDEP
SSKRRKHQGVIKRNWEYICSHDKEKTKILGDKNVDPKCEDSENKFDFSVMSYNILSQDLL
EDNSHLYRHCRRPVLHWSFRFPNILKEIKHFDADVLCLQEVQEDHYGAEIRPSLESLGYH
CEYKMRTGRKPDGCAICFKHSKFSLLSVNPVEFFRPDISLLDRDNVGLVLLLQPKIPYAA
CPAICVANTHLLYNPRRGDIKLTQLAMLLAEISSVAHQKDGSFCPIVMCGDFNSVPGSPL
YSFIKEGKLNYEGLPIGKVSGQEQSSRGQRILSIPIWPPNLGISQNCVYEVQQVPKVEKT
DSDLTQTQLKQTEVLVTAEKLSSNLQHHFSLSSVYSHYFPDTGIPEVTTCHSRSAITVDY
IFYSAEKEDVAGHPGAEVALVGGLKLLARLSLLTEQDLWTVNGLPNENNSSDHLPLLAKF
RLEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VTE6	1.000	1.000	0.000	544	1.000	1.000	Q5VTE6.pdb.gz	ANGE2_HUMAN Protein angel homolog 2 OS=Homo sapiens OX=9606 GN=ANGEL2 PE=1 SV=1
2	AFDB:F4J8R6	0.533	0.642	4.940E-34	449	0.246	0.298	F4J8R6.pdb.gz	F4J8R6_ARATH DNAse I-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=CCR4C PE=1 SV=1
3	PDB:7ax1A	0.498	0.522	1.251E-26	518	0.191	0.201	7ax1A.pdb.gz	Crystal structure and functional properties of the human CCR4-CAF1 deadenylase complex.
4	AFDB:F1N588	0.343	0.308	1.745E-12	612	0.169	0.150	F1N588.pdb.gz	F1N588_BOVIN sphingomyelin phosphodiesterase OS=Bos taurus OX=9913 GN=SMPD2 PE=1 SV=2
5	PDB:4f1iA	0.335	0.528	8.842E-12	328	0.090	0.149	4f1iA.pdb.gz
6	AFDB:Q15735	0.316	0.183	1.397E-9	1006	0.121	0.066	Q15735.pdb.gz	PI5PA_HUMAN Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Homo sapiens OX=9606 GN=INPP5J PE=1 SV=3
7	PDB:1akoA	0.302	0.563	1.733E-9	268	0.107	0.216	1akoA.pdb.gz
8	PDB:2imqX	0.298	0.517	2.771E-9	280	0.081	0.157	2imqX.pdb.gz	Heme-assisted S-nitrosation of a proximal thiolate in a nitric oxide transport protein
9	PDB:7kiuA	0.327	0.611	9.495E-9	263	0.088	0.183	7kiuA.pdb.gz	Structural features of Dnase1L3 responsible for serum antigen clearance.
10	PDB:4awnA	0.303	0.556	1.810E-8	260	0.083	0.173	4awnA.pdb.gz	The Structure of Human DNase I Bound to Magnesium and Phosphate Ions Points to a Catalytic Mechanism Common to Members of the DNase I-Like Superfamily.
11	AFDB:P27864	0.307	0.254	2.200E-8	679	0.138	0.110	P27864.pdb.gz	RRP1_DROME Recombination repair protein 1 OS=Drosophila melanogaster OX=7227 GN=Rrp1 PE=1 SV=2
12	PDB:2j63A	0.310	0.471	2.573E-8	333	0.099	0.162	2j63A.pdb.gz
13	PDB:7cd5A	0.299	0.539	4.626E-8	278	0.094	0.183	7cd5A.pdb.gz	APE1 distinguishes DNA substrates in exonucleolytic cleavage by induced space-filling.
14	PDB:2a3zB	0.301	0.570	6.974E-8	260	0.079	0.165	2a3zB.pdb.gz	Actin-bound structures of Wiskott-Aldrich syndrome protein (WASP)-homology domain 2 and the implications for filament assembly
15	PDB:6o1kA	0.306	0.571	8.818E-8	262	0.074	0.153	6o1kA.pdb.gz	Architectural principles for Hfq/Crc-mediated regulation of gene expression
16	AFDB:O80834	0.056	0.097	3.552E-1	348	0.061	0.095	O80834.pdb.gz	AHL9_ARATH AT-hook motif nuclear-localized protein 9 OS=Arabidopsis thaliana OX=3702 GN=AHL9 PE=2 SV=1
17	AFDB:F1R3X0	0.060	0.034	9.079E-1	1255	0.081	0.035	F1R3X0.pdb.gz
18	AFDB:P27476	0.075	0.096	1.021	414	0.070	0.092	P27476.pdb.gz	NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NSR1 PE=1 SV=1
19	AFDB:P30665	0.065	0.043	1.217	933	0.090	0.053	P30665.pdb.gz	MCM4_YEAST DNA replication licensing factor MCM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MCM4 PE=1 SV=2
20	AFDB:Q8GXB3	0.077	0.102	1.539	378	0.055	0.079	Q8GXB3.pdb.gz	AHL5_ARATH AT-hook motif nuclear-localized protein 5 OS=Arabidopsis thaliana OX=3702 GN=AHL5 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5VTE6	0.0	1135	544	1.000	1.000	ANGE2_HUMAN Protein angel homolog 2 OS=Homo sapiens OX=9606 GN=ANGEL2 PE=1 SV=1
2	Q9UNK9	6.73e-110	344	670	0.377	0.306	ANGE1_HUMAN Protein angel homolog 1 OS=Homo sapiens OX=9606 GN=ANGEL1 PE=1 SV=1
3	Q8VYU4	1.97e-35	143	754	0.160	0.115	CCR4F_ARATH Carbon catabolite repressor protein 4 homolog 6 OS=Arabidopsis thaliana OX=3702 GN=CCR4-6 PE=2 SV=2
4	F4J8R6	9.60e-35	138	449	0.213	0.258	F4J8R6_ARATH DNAse I-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=CCR4C PE=1 SV=1
5	Q8W0Z9	9.95e-30	125	602	0.219	0.198	CCR4A_ARATH Carbon catabolite repressor protein 4 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=CCR4-1 PE=2 SV=1
6	O74874	2.79e-24	109	690	0.145	0.114	CCR4_SCHPO CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ccr4 PE=1 SV=1
7	H0Y9C1	3.62e-24	107	435	0.125	0.156	H0Y9C1_HUMAN poly(A)-specific ribonuclease OS=Homo sapiens OX=9606 GN=CNOT6L PE=1 SV=2
8	Q8VEG6	4.22e-24	108	555	0.125	0.123	CNO6L_MOUSE CCR4-NOT transcription complex subunit 6-like OS=Mus musculus OX=10090 GN=Cnot6l PE=1 SV=2
9	H0Y9Z5	1.19e-23	107	550	0.125	0.124	H0Y9Z5_HUMAN poly(A)-specific ribonuclease OS=Homo sapiens OX=9606 GN=CNOT6L PE=1 SV=2
10	Q96LI5	1.32e-23	106	555	0.125	0.123	CNO6L_HUMAN CCR4-NOT transcription complex subunit 6-like OS=Homo sapiens OX=9606 GN=CNOT6L PE=1 SV=2
11	Q7K112	1.44e-23	106	552	0.136	0.134	Q7K112_DROME poly(A)-specific ribonuclease OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=1
12	Q9VCB6	1.56e-23	106	545	0.127	0.127	Q9VCB6_DROME poly(A)-specific ribonuclease OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=2
13	Q8IMX1	1.60e-23	106	567	0.136	0.131	Q8IMX1_DROME poly(A)-specific ribonuclease OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=1
14	Q8MTZ5	1.62e-23	106	566	0.136	0.131	Q8MTZ5_DROME poly(A)-specific ribonuclease (Fragment) OS=Drosophila melanogaster OX=7227 GN=twin PE=2 SV=1
15	Q9ULM6	7.73e-23	104	557	0.127	0.124	CNOT6_HUMAN CCR4-NOT transcription complex subunit 6 OS=Homo sapiens OX=9606 GN=CNOT6 PE=1 SV=2
16	Q8IMX0	7.76e-23	102	358	0.132	0.201	Q8IMX0_DROME Twin, isoform D OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=1
17	Q9U1P4	1.49e-22	103	613	0.131	0.116	Q9U1P4_CAEEL poly(A)-specific ribonuclease OS=Caenorhabditis elegans OX=6239 GN=ccr-4 PE=1 SV=2
18	Q6L8Q7	1.59e-22	103	609	0.131	0.117	PDE12_HUMAN 2',5'-phosphodiesterase 12 OS=Homo sapiens OX=9606 GN=PDE12 PE=1 SV=2
19	P31384	1.20e-21	101	837	0.156	0.102	CCR4_YEAST CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CCR4 PE=1 SV=2
20	Q08DF7	1.27e-21	100	609	0.129	0.115	PDE12_BOVIN 2',5'-phosphodiesterase 12 OS=Bos taurus OX=9913 GN=PDE12 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19339 ANGEL2_N	8.2e-58	206.5	Protein angel homolog 2 N-terminal
2	PF03372 Exo_endo_phos	6.8e-24	96.3	Endonuclease/Exonuclease/phosphatase family
3	PF14529 Exo_endo_phos_2	3.1e+02	12.6	Endonuclease-reverse transcriptase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355929

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000430493	0.914	CCR4-NOT transcription complex subunit 8
2	9606.ENSP00000361162	0.909	Target of EGR1 protein 1
3	9606.ENSP00000355279	0.894	CCR4-NOT transcription complex subunit 7
4	9606.ENSP00000229195	0.874	CCR4-NOT transcription complex subunit 2
5	9606.ENSP00000273064	0.816	CCR4-NOT transcription complex subunit 9
6	9606.ENSP00000320949	0.811	CCR4-NOT transcription complex subunit 1
7	9606.ENSP00000445508	0.796	CCR4-NOT transcription complex subunit 4
8	9606.ENSP00000351159	0.779	CCR4-NOT transcription complex subunit 3
9	9606.ENSP00000264951	0.654	5'-3' exoribonuclease 1
10	9606.ENSP00000369431	0.647	Caspase activity and apoptosis inhibitor 1
11	9606.ENSP00000401721	0.617	PAN2-PAN3 deadenylation complex catalytic subunit PAN2
12	9606.ENSP00000356985	0.616	Death effector domain-containing protein
13	9606.ENSP00000387911	0.583	Poly(A)-specific ribonuclease PARN
14	9606.ENSP00000366135	0.581	Exosome component 10
15	9606.ENSP00000265881	0.573	Oligoribonuclease, mitochondrial
16	9606.ENSP00000369346	0.554	Arylsulfatase family member K
17	9606.ENSP00000338173	0.553	Pumilio homolog 2
18	9606.ENSP00000278198	0.552	Leucine-rich repeat-containing protein 4C
19	9606.ENSP00000478754	0.542	Probable ATP-dependent RNA helicase DDX6
20	9606.ENSP00000268655	0.531	Zinc finger protein 174

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003730	1.000	mRNA 3'-UTR binding
GO:0003824	0.949	catalytic activity
GO:0016788	0.937	hydrolase activity, acting on ester bonds
GO:0005515	0.929	protein binding
GO:0004518	0.910	nuclease activity
GO:0140640	0.895	catalytic activity, acting on a nucleic acid
GO:0004527	0.718	exonuclease activity
GO:0140098	0.626	catalytic activity, acting on RNA
GO:0004540	0.556	ribonuclease activity
GO:0008408	0.319	3'-5' exonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0080090	0.991	regulation of primary metabolic process
GO:0051171	0.991	regulation of nitrogen compound metabolic process
GO:0031323	0.991	regulation of cellular metabolic process
GO:0010468	0.988	regulation of gene expression
GO:1902369	0.984	negative regulation of RNA catabolic process
GO:0010628	0.980	positive regulation of gene expression
GO:0043488	0.976	regulation of mRNA stability
GO:0043489	0.962	RNA stabilization
GO:1902373	0.942	negative regulation of mRNA catabolic process
GO:0048255	0.902	mRNA stabilization
GO:0051726	0.827	regulation of cell cycle
GO:0009987	0.796	cellular process
GO:0007346	0.780	regulation of mitotic cell cycle
GO:0071704	0.648	organic substance metabolic process
GO:0044238	0.642	primary metabolic process
GO:0044237	0.635	cellular metabolic process
GO:0006807	0.602	nitrogen compound metabolic process
GO:0043170	0.549	macromolecule metabolic process
GO:0048522	0.532	positive regulation of cellular process
GO:0045786	0.516	negative regulation of cell cycle
GO:0045930	0.492	negative regulation of mitotic cell cycle
GO:0006139	0.431	nucleobase-containing compound metabolic process
GO:0031326	0.423	regulation of cellular biosynthetic process
GO:0010556	0.407	regulation of macromolecule biosynthetic process
GO:0090304	0.369	nucleic acid metabolic process
GO:0051173	0.339	positive regulation of nitrogen compound metabolic process
GO:0016070	0.337	RNA metabolic process
GO:0031325	0.326	positive regulation of cellular metabolic process
GO:0010558	0.321	negative regulation of macromolecule biosynthetic process
GO:0031327	0.320	negative regulation of cellular biosynthetic process
GO:0010629	0.318	negative regulation of gene expression
GO:0044260	0.301	cellular macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0031981	0.996	nuclear lumen
GO:0005654	0.993	nucleoplasm
GO:0005829	0.944	cytosol
GO:0032991	0.893	protein-containing complex
GO:0015030	0.811	Cajal body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.937	Acting on ester bonds.

[back to server]