StarFunc result for job id Q5VTH9

User Input

>input (848 residues)
MTPGKHSGASARAANGGAWGYRDFRGGQKKGWCTTPQLVATMPVSPAGSHKQQNFGLNNA
TQPKKSISFFATMKATSVKGYTGANQSRMAVSKTVLIPPELKTVEKPNPNIKTTQVFDIN
GTDVTPRPLYHPDPLTGTAKPSKLLTSQEGSLGSEFISSYSLYQNTINPSTLGQFTRSVL
GSSTVSKSSVSASESIAEDLEEPSYKRERLTSFTDLQVIRAAPEKIVTKEDLEKNIEIIL
TETETLRFFDLPTVMVSVESEEAEKVTQRNKNYEVLCRNRLGNDLYVERMMQTFNGAPKN
KDVQCDKIIMEDKGIMSTAWDLYDSYNAMELVSLSVKQSVVESSSKANVLPKDQDQRLPG
STTEKNSETSSLMDIENVILAKIHEDEEDHSDAILKSDKFHQDLFFMERVLMENIFQPKL
AAYRQLPVLKEPEPEEPEDVLESAKHEEVEEESKKEEEEEIHAEESTIPANLERLWSFSC
DLTKGLNVSSLAWNKTNPDLLAVGYGHFGFKEQKRGLACCWSIKNPMWPERIYQSPYGVT
AVDFSIGAPNLLAVGYHNGTIAIYNVRSNSNVPVLDSSESPQKHLGPVWQLQWIEQDRGT
TGDGKREILVSISADGRISKWVIRKGLDCYDLMRLKRTTAASNKKGGEKEKKDEALISRQ
APGMCFAFHPKDTNIYLAGTEEGHIHKCSCSYNEQYLDTYRGHKGPVYKVTWNPFCHDVF
LSCSADWGVIIWQQENVKPSLSFYPATSVVYDVAWSPKSSYIFAAANENRVEIWDLHIST
LDPLIVNTANPGIKFTTILFAKQTDCLLVGDSDGQVSVYELRNMPTVLETGRGDIMDTLL
GSKSNQSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7kzmD	0.429	0.778	5.156E-34	456	0.156	0.289	7kzmD.pdb.gz	Structure of a microtubule-bound axonemal dynein.
2	PDB:7kzmE	0.370	0.642	3.316E-22	474	0.105	0.188	7kzmE.pdb.gz	Structure of a microtubule-bound axonemal dynein.
3	PDB:6rlbD	0.373	0.682	5.421E-22	446	0.117	0.222	6rlbD.pdb.gz
4	PDB:6f1tp	0.343	0.693	7.055E-21	401	0.120	0.254	6f1tp.pdb.gz	Cryo-EM shows how dynactin recruits two dyneins for faster movement.
5	PDB:6rlbC	0.323	0.526	6.207E-19	494	0.101	0.174	6rlbC.pdb.gz
6	PDB:7bt6x	0.297	0.487	3.761E-18	488	0.066	0.115	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
7	PDB:3dm0A	0.321	0.400	1.005E-17	675	0.078	0.098	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
8	PDB:7vggA	0.309	0.819	1.832E-17	304	0.071	0.197	7vggA.pdb.gz
9	PDB:2h9lA	0.314	0.780	2.995E-17	321	0.065	0.171	2h9lA.pdb.gz
10	PDB:7jvrB	0.316	0.737	8.451E-17	342	0.055	0.137	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
11	AFDB:D6W4T8	0.290	0.201	9.804E-14	1266	0.125	0.084	D6W4T8.pdb.gz	D6W4T8_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=pod1 PE=1 SV=1
12	AFDB:O88466	0.305	0.141	7.391E-13	1888	0.132	0.059	O88466.pdb.gz	ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3
13	AFDB:A1Z7J7	0.328	0.229	2.027E-9	1240	0.065	0.044	A1Z7J7.pdb.gz	A1Z7J7_DROME Secretory 31, isoform A OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=1 SV=1
14	AFDB:A0A0B4LEZ1	0.328	0.225	2.388E-9	1260	0.066	0.044	A0A0B4LEZ1.pdb.gz	A0A0B4LEZ1_DROME Secretory 31, isoform D OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=1 SV=1
15	AFDB:M9PBJ7	0.255	0.186	6.041E-9	1213	0.104	0.073	M9PBJ7.pdb.gz	M9PBJ7_DROME Misshapen, isoform H OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1
16	AFDB:F1M754	0.281	0.209	2.240E-8	1178	0.129	0.093	F1M754.pdb.gz	F1M754_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=3
17	AFDB:D6REX3	0.321	0.222	2.638E-8	1251	0.059	0.040	D6REX3.pdb.gz	D6REX3_HUMAN SEC31 homolog A, COPII coat complex component OS=Homo sapiens OX=9606 GN=SEC31A PE=1 SV=1
18	AFDB:A0A024RDH6	0.323	0.236	2.943E-8	1181	0.062	0.045	A0A024RDH6.pdb.gz
19	AFDB:Q3UPL0	0.323	0.228	4.810E-8	1230	0.067	0.046	Q3UPL0.pdb.gz	SC31A_MOUSE Protein transport protein Sec31A OS=Mus musculus OX=10090 GN=Sec31a PE=1 SV=2
20	AFDB:A0A0G2K490	0.268	0.176	1.217E-7	1360	0.132	0.082	A0A0G2K490.pdb.gz	A0A0G2K490_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PYY5	0.0	1176	807	0.709	0.745	DNAI4_MOUSE Dynein axonemal intermediate chain 4 OS=Mus musculus OX=10090 GN=Dnai4 PE=1 SV=1
2	F1QHZ6	0.0	660	778	0.400	0.436	DNAI4_DANRE Dynein axonemal intermediate chain 4 OS=Danio rerio OX=7955 GN=dnai4 PE=2 SV=1
3	Q6GPB9	0.0	806	742	0.471	0.538	DNAI4_XENLA Dynein axonemal intermediate chain 4 OS=Xenopus laevis OX=8355 GN=dnai4 PE=2 SV=1
4	Q5XPS1	1.99e-72	259	1057	0.153	0.123	Q5XPS1_CHLRE Axonemal inner arm I1 intermediate chain dynein IC138 OS=Chlamydomonas reinhardtii OX=3055 GN=BOP5 PE=1 SV=1
5	Q586W0	2.56e-70	251	864	0.226	0.222	Q586W0_TRYB2 Dynein intermediate chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=28H13.380 PE=4 SV=1
6	A0A286ZPL5	3.61e-67	239	704	0.167	0.202	A0A286ZPL5_PIG Dynein axonemal intermediate chain 1 OS=Sus scrofa OX=9823 GN=DNAI1 PE=4 SV=2
7	Q8C0M8	3.77e-65	233	701	0.162	0.195	DNAI1_MOUSE Dynein axonemal intermediate chain 1 OS=Mus musculus OX=10090 GN=Dnai1 PE=1 SV=1
8	Q9UI46	4.06e-65	233	699	0.154	0.187	DNAI1_HUMAN Dynein axonemal intermediate chain 1 OS=Homo sapiens OX=9606 GN=DNAI1 PE=1 SV=1
9	Q5XIL8	5.59e-65	233	705	0.160	0.193	DNAI1_RAT Dynein axonemal intermediate chain 1 OS=Rattus norvegicus OX=10116 GN=Dnai1 PE=1 SV=1
10	A0A0D9RCF4	6.62e-65	232	693	0.153	0.188	A0A0D9RCF4_CHLSB Dynein axonemal intermediate chain 1 OS=Chlorocebus sabaeus OX=60711 GN=DNAI1 PE=4 SV=1
11	Q385R8	2.11e-64	230	655	0.229	0.296	Q385R8_TRYB2 Dynein intermediate chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2640 PE=4 SV=1
12	Q8MSJ9	3.46e-55	206	739	0.138	0.158	Q8MSJ9_DROME GH05829p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9313 PE=2 SV=1
13	A0A0B4LG18	3.61e-55	206	740	0.138	0.158	A0A0B4LG18_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9313 PE=4 SV=1
14	Q39578	1.93e-50	191	683	0.146	0.182	DYI2_CHLRE Dynein, 78 kDa intermediate chain, flagellar outer arm OS=Chlamydomonas reinhardtii OX=3055 GN=ODA9 PE=1 SV=3
15	Q8T0V3	5.42e-45	175	684	0.175	0.216	Q8T0V3_DROME Dynein intermediate chain at 61B, isoform B OS=Drosophila melanogaster OX=7227 GN=Dic61B PE=2 SV=1
16	Q9W0U9	1.57e-44	174	764	0.175	0.194	Q9W0U9_DROME Dynein intermediate chain at 61B, isoform A OS=Drosophila melanogaster OX=7227 GN=Dic61B PE=4 SV=1
17	Q8IGZ6	1.67e-44	174	791	0.175	0.187	Q8IGZ6_DROME LP11180p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dic61B PE=2 SV=1
18	O88487	7.26e-29	125	612	0.113	0.157	DC1I2_MOUSE Cytoplasmic dynein 1 intermediate chain 2 OS=Mus musculus OX=10090 GN=Dync1i2 PE=1 SV=1
19	Q13409	1.31e-28	124	638	0.110	0.146	DC1I2_HUMAN Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3
20	E7F6H7	3.53e-28	123	626	0.108	0.147	DCI2A_DANRE Dynein, cytoplasmic 1, intermediate chain 2a OS=Danio rerio OX=7955 GN=dync1i2a PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.00039	32.0	Anaphase-promoting complex subunit 4 WD40 domain
2	PF16687 ELYS-bb	5e+02	10.7	beta-propeller of ELYS nucleoporin
3	PF00400 WD40	3.3e-05	35.7	WD domain, G-beta repeat
4	PF17005 WD40_like	3.1e+02	12.1	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360065

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000294664	0.908	WD repeat-containing protein 63
2	9606.ENSP00000355051	0.845	Transcription initiation factor TFIID subunit 13
3	9606.ENSP00000307684	0.843	Transcriptional adapter 3
4	9606.ENSP00000417510	0.834	SPT20 homolog, SAGA complex component
5	9606.ENSP00000360515	0.824	Transcription initiation protein SPT3 homolog
6	9606.ENSP00000352925	0.821	Transformation/transcription domain-associated protein
7	9606.ENSP00000340271	0.749	Transcription initiation factor TFIID subunit 3
8	9606.ENSP00000263974	0.745	Transcription initiation factor TFIID subunit 12
9	9606.ENSP00000362068	0.738	Transcription initiation factor TFIID subunit 8
10	9606.ENSP00000367406	0.737	Transcription initiation factor TFIID subunit 2
11	9606.ENSP00000410759	0.736	Ataxin-7-like protein 1
12	9606.ENSP00000439585	0.736	Ataxin-7
13	9606.ENSP00000354633	0.735	Transcription initiation factor TFIID subunit 11
14	9606.ENSP00000299424	0.733	Transcription initiation factor TFIID subunit 10
15	9606.ENSP00000311273	0.684	Dynein heavy chain 7, axonemal
16	9606.ENSP00000458355	0.684	Dynein heavy chain 2, axonemal
17	9606.ENSP00000400252	0.664	Dynein intermediate chain 2, axonemal
18	9606.ENSP00000237264	0.647	TATA box-binding protein-like protein 1
19	9606.ENSP00000247219	0.647	TATA box-binding protein-like protein 2
20	9606.ENSP00000302724	0.647	Insulin-like peptide INSL5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007017	0.997	microtubule-based process
GO:0016043	0.985	cellular component organization
GO:0007018	0.981	microtubule-based movement
GO:0044085	0.973	cellular component biogenesis
GO:0022607	0.956	cellular component assembly
GO:0006996	0.955	organelle organization
GO:0003341	0.938	cilium movement
GO:0044782	0.919	cilium organization
GO:0048856	0.739	anatomical structure development
GO:0050789	0.669	regulation of biological process
GO:0007010	0.651	cytoskeleton organization
GO:0050794	0.603	regulation of cellular process
GO:0120031	0.596	plasma membrane bounded cell projection assembly
GO:0065003	0.535	protein-containing complex assembly
GO:0070925	0.478	organelle assembly
GO:0060271	0.452	cilium assembly
GO:0000226	0.427	microtubule cytoskeleton organization
GO:0001578	0.398	microtubule bundle formation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005929	0.997	cilium
GO:1902494	0.996	catalytic complex
GO:0015630	0.982	microtubule cytoskeleton
GO:0097014	0.959	ciliary plasm
GO:0005930	0.952	axoneme
GO:0030286	0.854	dynein complex
GO:0005634	0.836	nucleus
GO:0005858	0.810	axonemal dynein complex
GO:0031514	0.474	motile cilium
GO:0070013	0.387	intracellular organelle lumen
GO:0031981	0.384	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]