StarFunc result for job id Q5VTM2

User Input

>input (703 residues)
MFEDVFSDSGNTGNFDRGKKRRLTIIECGCDINMMIDLAKVADLVLMLIDASFGFEMEMF
EFLNICQAHGFPKILGVLTHLDSFKHNKQLKKTKKRLKHRFWTEVYQDKVGLTHELVQSL
ISTYSTIDAKMASSRVTLLSNSKPLGSEAIDNQGVSLEFDQQQGSVCPSESEIYEAGAED
RMAGAPMAAAVQPAEVTVEVGEDLHMHQVRDREMPEVVEIRRSNCTNHCDLGDTSSYHTK
VSTVHIMKKRNGGGSLNNYSSSIPPTPSTSQEDPQFSVPPTANTPTPVCKRSMRWSNLFT
SEKGSDPDKERKAPENHADTIGSGRAIPIKQGMLLKRSGKWLKTWKKKYVTLCSNGVLTY
YSSLGDYMKNIHKKEIDLRTSTIKVPGKWPSLATSACAPISSSKSNGLSKDMDTGLGDSI
CFSPGISSTTSPKLNPPPSPHANKKKHLKKKSTNNFMIVSATGQTWHFEATTYEERDAWV
QAIQSQILASLQSCKSSKSKSQLTSQSEAMALQSIQNMRGNAHCVDCETQNPKWASLNLG
VLMCIECSGIHRSFGTRLSRVRSLELDDWPVELRKVMSSIGNELANSIWEGSSQGQTKPS
IKSTREEKEWWIRSKYEEKLFLAPLPCTELSLGQQLLRATTDEDLQTAILLLAHGSREEV
NETCGEGDGCTALHLACRKGNVVLEQLLTGWTSWPEMPTGTQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WZ64	0.247	0.116	2.681E-17	1704	0.155	0.064	Q8WZ64.pdb.gz	ARAP2_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARAP2 PE=1 SV=3
2	PDB:3lvqE	0.231	0.379	7.638E-11	420	0.084	0.140	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
3	PDB:3ljuX	0.168	0.311	4.076E-9	373	0.061	0.115	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
4	PDB:7mq9SI	0.132	0.111	6.667E-8	844	0.125	0.104	7mq9SI.pdb.gz	Nucleolar maturation of the human small subunit processome.
5	PDB:7mqaSI	0.124	0.109	8.722E-8	803	0.122	0.107	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.
6	PDB:7wtlCL	0.125	0.144	1.851E-7	610	0.087	0.100	7wtlCL.pdb.gz	In vitro structural maturation of an early stage pre-40S particle coupled with U3 snoRNA release and central pseudoknot formation.
7	PDB:7d63RJ	0.122	0.108	1.151E-6	796	0.085	0.075	7d63RJ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)
8	PDB:7ajuCL	0.131	0.115	3.027E-6	808	0.092	0.080	7ajuCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
9	PDB:7ajtCL	0.138	0.125	4.911E-6	781	0.092	0.083	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
10	PDB:7d4iRJ	0.131	0.124	1.160E-5	738	0.091	0.087	7d4iRJ.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
11	PDB:3o47A	0.116	0.271	1.235E-4	289	0.046	0.111	3o47A.pdb.gz	Crystal structure of ARFGAP1-ARF1 fusion protein
12	AFDB:Q6DFV3	0.128	0.049	5.159E-3	1944	0.078	0.028	Q6DFV3.pdb.gz	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2
13	AFDB:P34288	0.127	0.057	5.745E-3	1605	0.081	0.036	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
14	AFDB:Q13009	0.135	0.064	1.683E-2	1591	0.111	0.049	Q13009.pdb.gz	TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 OS=Homo sapiens OX=9606 GN=TIAM1 PE=1 SV=2
15	AFDB:Q99KW3	0.122	0.045	8.439E-2	2014	0.080	0.028	Q99KW3.pdb.gz	TARA_MOUSE TRIO and F-actin-binding protein OS=Mus musculus OX=10090 GN=Triobp PE=1 SV=3
16	AFDB:O74653	0.106	0.086	8.905E-2	871	0.104	0.084	O74653.pdb.gz	POB1_SCHPO Protein pob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pob1 PE=1 SV=1
17	AFDB:P35761	0.070	0.060	1.165E-1	856	0.094	0.077	P35761.pdb.gz	TTK_MOUSE Dual specificity protein kinase TTK OS=Mus musculus OX=10090 GN=Ttk PE=1 SV=1
18	AFDB:Q580H3	0.067	0.074	2.220E-1	601	0.087	0.101	Q580H3.pdb.gz	Q580H3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O9.140 PE=4 SV=1
19	AFDB:A0A1D8PRW9	0.123	0.076	2.753E-1	1172	0.088	0.053	A0A1D8PRW9.pdb.gz	A0A1D8PRW9_CANAL Boi2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BOI2 PE=4 SV=1
20	AFDB:Q04724	0.054	0.050	3.601E-1	770	0.081	0.074	Q04724.pdb.gz	TLE1_HUMAN Transducin-like enhancer protein 1 OS=Homo sapiens OX=9606 GN=TLE1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	U6A022	2.25e-169	508	808	0.380	0.330	U6A022_RAT ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 OS=Rattus norvegicus OX=10116 GN=Agap3 PE=2 SV=1
2	Q8VHH5	1.39e-161	491	910	0.394	0.304	AGAP3_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Agap3 PE=1 SV=1
3	Q9UPQ3	4.85e-154	469	857	0.349	0.286	AGAP1_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AGAP1 PE=1 SV=4
4	J3KNM6	3.32e-122	391	1036	0.309	0.209	J3KNM6_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 (Fragment) OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
5	F8VVT9	5.70e-118	383	1192	0.312	0.184	F8VVT9_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
6	Q99490	7.08e-118	383	1192	0.312	0.184	AGAP2_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=2
7	Q8CGU4	1.50e-111	366	1186	0.312	0.185	AGAP2_RAT Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Agap2 PE=1 SV=1
8	Q3UHD9	1.70e-111	365	1186	0.312	0.185	AGAP2_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Agap2 PE=1 SV=1
9	A0JMI1	1.91e-107	347	827	0.306	0.260	A0JMI1_DANRE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Danio rerio OX=7955 GN=agap2 PE=2 SV=1
10	Q9XX14	6.31e-69	246	1107	0.239	0.152	CNT2_CAEEL Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 OS=Caenorhabditis elegans OX=6239 GN=cnt-2 PE=1 SV=2
11	Q9NGC3	2.89e-63	229	995	0.175	0.124	CEG1A_DROME Centaurin-gamma-1A OS=Drosophila melanogaster OX=7227 GN=CenG1A PE=2 SV=2
12	Q14692	3.42e-50	192	1282	0.122	0.067	BMS1_HUMAN Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens OX=9606 GN=BMS1 PE=1 SV=1
13	E7F349	1.17e-42	169	1221	0.110	0.063	E7F349_DANRE BMS1 ribosome biogenesis factor OS=Danio rerio OX=7955 GN=bms1l PE=1 SV=2
14	Q4QQN0	1.92e-34	141	626	0.115	0.129	Q4QQN0_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
15	A2ADA6	2.42e-34	142	829	0.115	0.098	A2ADA6_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
16	Q6NXL5	2.82e-34	142	833	0.115	0.097	Q6NXL5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
17	Q3UH98	2.90e-34	142	833	0.115	0.097	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
18	O94653	1.14e-33	140	1121	0.087	0.054	BMS1_SCHPO Ribosome biogenesis protein bms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bms1 PE=1 SV=2
19	Q08965	1.18e-32	137	1183	0.088	0.052	BMS1_YEAST Ribosome biogenesis protein BMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BMS1 PE=1 SV=1
20	Q54WI0	2.14e-31	134	1333	0.158	0.083	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	15	17.4	Ankyrin repeat
2	PF12796 Ank_2	58	15.7	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	13	17.6	Ankyrin repeat
4	PF13637 Ank_4	14	17.7	Ankyrin repeats (many copies)
5	PF01412 ArfGap	1.5e-32	123.5	Putative GTPase activating protein for Arf
6	PF00009 GTP_EFTU	7.8	17.5	Elongation factor Tu GTP binding domain
7	PF00169 PH	2.4e-06	39.4	PH domain
8	PF15413 PH_11	0.17	23.8	Pleckstrin homology domain
9	PF15404 PH_4	76	14.6	Pleckstrin homology domain
10	PF15406 PH_6	4.2	19.1	Pleckstrin homology domain
11	PF15409 PH_8	5.3	18.7	Pleckstrin homology domain
12	PF15410 PH_9	1.4e+02	14.0	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000019508

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000013490	0.984	UTP6, small subunit (SSU) processome component, homolog (yeast)
2	61853.ENSNLEP00000000293	0.982	NOP14 nucleolar protein
3	61853.ENSNLEP00000002350	0.982	annotation not available
4	61853.ENSNLEP00000004265	0.982	HEAT repeat containing 1
5	61853.ENSNLEP00000006599	0.982	UTP4, small subunit processome component
6	61853.ENSNLEP00000013909	0.982	WD repeat domain 36
7	61853.ENSNLEP00000010903	0.980	Transducin (beta)-like 3
8	61853.ENSNLEP00000012515	0.980	U3 small nucleolar ribonucleoprotein protein MPP10
9	61853.ENSNLEP00000024095	0.977	WD repeat domain 3
10	61853.ENSNLEP00000016869	0.976	Nucleolar protein 10
11	61853.ENSNLEP00000023998	0.976	RNA cytidine acetyltransferase
12	61853.ENSNLEP00000005756	0.975	UTP15, small subunit processome component
13	61853.ENSNLEP00000007547	0.975	UTP20, small subunit (SSU) processome component, homolog (yeast)
14	61853.ENSNLEP00000005877	0.973	Bystin-like
15	61853.ENSNLEP00000006148	0.973	Nucleolar protein 6 (RNA-associated)
16	61853.ENSNLEP00000008598	0.973	Ribosomal RNA processing 9, small subunit (SSU) processome component, homolog (yeast)
17	61853.ENSNLEP00000012425	0.973	Ribosomal L1 domain containing 1
18	61853.ENSNLEP00000005659	0.972	KRR1 small subunit processome component
19	61853.ENSNLEP00000008541	0.972	NOP58 ribonucleoprotein
20	61853.ENSNLEP00000008326	0.969	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0005543	0.990	phospholipid binding
GO:0043167	0.841	ion binding
GO:0043168	0.749	anion binding
GO:0003824	0.552	catalytic activity
GO:1901363	0.473	heterocyclic compound binding
GO:0097159	0.463	organic cyclic compound binding
GO:0003676	0.336	nucleic acid binding
GO:0003723	0.331	RNA binding
GO:0098772	0.320	molecular function regulator activity
GO:0016787	0.311	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.971	developmental process
GO:0009987	0.904	cellular process
GO:0048856	0.862	anatomical structure development
GO:0032501	0.829	multicellular organismal process
GO:0007275	0.622	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.998	nuclear lumen
GO:0005737	0.957	cytoplasm
GO:0043232	0.574	intracellular non-membrane-bounded organelle
GO:0005654	0.549	nucleoplasm
GO:0005829	0.489	cytosol
GO:0016020	0.320	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.311	Hydrolases.

[back to server]