StarFunc result for job id Q5VTT5

User Input

>input (1437 residues)
MTLPHSLGGAGDPRPPQAMEVHRLEHRQEEEQKEERQHSLRMGSSVRRRTFRSSEEEHEF
SAADYALAAALALTASSELSWEAQLRRQTSAVELEERGQKRVGFGNDWERTEIAFLQTHR
LLRQRRDWKTLRRRTEEKVQEAKELRELCYGRGPWFWIPLRSHAVWEHTTVLLTCTVQAS
PPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAIEDSATYTVRVKNAHGQAS
SFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDVLD
AESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYV
LVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYTIERCQGESGEWI
ACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVPSKASELVVMGDHDAARRKTEIP
FDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRDRAPLTYSLEKSV
IGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPPA
TLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFTV
PGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGW
KPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWA
GVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYMGAGPVTGYHVSF
QEEGSEQWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAMNSAGLGQPSMPTDPVLLEDKP
GAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKE
PGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERG
EVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTA
QLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTC
KVTNTKKETRFQWFFQRAEMPDGQYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDT
ILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKR
LESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEH
QRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDR
YRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELKSM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K5P5	0.205	0.181	0.000	1688	0.395	0.336	A0A0G2K5P5.pdb.gz	A0A0G2K5P5_RAT Myomesin 1 OS=Rattus norvegicus OX=10116 GN=Myom1 PE=1 SV=2
2	AFDB:A2ABU4	0.244	0.244	0.000	1439	0.832	0.831	A2ABU4.pdb.gz	MYOM3_MOUSE Myomesin-3 OS=Mus musculus OX=10090 GN=Myom3 PE=1 SV=1
3	AFDB:G3V7K1	0.216	0.213	0.000	1464	0.415	0.408	G3V7K1.pdb.gz	G3V7K1_RAT Myomesin 2 OS=Rattus norvegicus OX=10116 GN=Myom2 PE=1 SV=2
4	AFDB:P52179	0.211	0.182	0.000	1685	0.393	0.335	P52179.pdb.gz	MYOM1_HUMAN Myomesin-1 OS=Homo sapiens OX=9606 GN=MYOM1 PE=1 SV=2
5	AFDB:P54296	0.215	0.211	0.000	1465	0.415	0.408	P54296.pdb.gz	MYOM2_HUMAN Myomesin-2 OS=Homo sapiens OX=9606 GN=MYOM2 PE=1 SV=3
6	AFDB:Q5VTT5	1.000	1.000	0.000	1437	1.000	1.000	Q5VTT5.pdb.gz	MYOM3_HUMAN Myomesin-3 OS=Homo sapiens OX=9606 GN=MYOM3 PE=1 SV=1
7	AFDB:Q62234	0.192	0.169	0.000	1667	0.386	0.332	Q62234.pdb.gz	MYOM1_MOUSE Myomesin-1 OS=Mus musculus OX=10090 GN=Myom1 PE=1 SV=2
8	AFDB:Q86VF2	0.093	0.104	9.115E-53	1251	0.164	0.188	Q86VF2.pdb.gz	IGFN1_HUMAN Immunoglobulin-like and fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IGFN1 PE=1 SV=2
9	AFDB:A0A140LGX4	0.094	0.126	6.196E-52	1010	0.118	0.168	A0A140LGX4.pdb.gz
10	AFDB:O75147	0.132	0.112	1.086E-51	1896	0.123	0.093	O75147.pdb.gz	OBSL1_HUMAN Obscurin-like protein 1 OS=Homo sapiens OX=9606 GN=OBSL1 PE=1 SV=4
11	PDB:1e07A	0.102	0.176	1.509E-18	642	0.072	0.160	1e07A.pdb.gz
12	PDB:5oj2B	0.100	0.147	2.582E-16	692	0.076	0.158	5oj2B.pdb.gz
13	PDB:7sqcO0	0.069	0.080	7.387E-14	1140	0.077	0.096	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:6pxvA	0.079	0.117	3.975E-13	823	0.042	0.074	6pxvA.pdb.gz
15	PDB:8dtlA	0.078	0.127	4.792E-13	741	0.042	0.081	8dtlA.pdb.gz
16	PDB:7q5zA	0.078	0.082	7.648E-13	1344	0.064	0.068	7q5zA.pdb.gz
17	PDB:8eyyA	0.078	0.121	3.258E-12	775	0.042	0.077	8eyyA.pdb.gz
18	PDB:7vonA	0.097	0.099	5.448E-12	1399	0.074	0.076	7vonA.pdb.gz
19	PDB:2rcjC	0.084	0.158	1.048E-11	523	0.045	0.124	2rcjC.pdb.gz
20	PDB:5a42A	0.070	0.064	1.151E-11	1597	0.082	0.074	5a42A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K5P5	0.0	700	1676	0.289	0.248	A0A0G2K5P5_RAT Myomesin 1 OS=Rattus norvegicus OX=10116 GN=Myom1 PE=1 SV=2
2	A0A8I6AC90	0.0	1128	1541	0.399	0.372	A0A8I6AC90_RAT Myomesin 2 OS=Rattus norvegicus OX=10116 GN=Myom2 PE=1 SV=1
3	A0A8I6GBP8	0.0	742	1689	0.300	0.255	A0A8I6GBP8_RAT Myomesin 1 OS=Rattus norvegicus OX=10116 GN=Myom1 PE=1 SV=1
4	A0A8I6GFM8	0.0	1022	1592	0.388	0.351	A0A8I6GFM8_RAT Myomesin 1 OS=Rattus norvegicus OX=10116 GN=Myom1 PE=1 SV=1
5	A2ABU4	0.0	2456	1439	0.832	0.831	MYOM3_MOUSE Myomesin-3 OS=Mus musculus OX=10090 GN=Myom3 PE=1 SV=1
6	E1BF23	0.0	1152	1495	0.418	0.402	E1BF23_BOVIN Myomesin 2 OS=Bos taurus OX=9913 GN=MYOM2 PE=4 SV=3
7	F1N9Z6	0.0	1058	1587	0.400	0.362	F1N9Z6_CHICK Myomesin 1 OS=Gallus gallus OX=9031 GN=MYOM1 PE=4 SV=4
8	G3V7K1	0.0	1111	1472	0.397	0.388	G3V7K1_RAT Myomesin 2 OS=Rattus norvegicus OX=10116 GN=Myom2 PE=1 SV=2
9	O55124	0.0	1131	1463	0.403	0.396	O55124_MOUSE M-protein OS=Mus musculus OX=10090 GN=Myom2 PE=2 SV=1
10	P52179	0.0	736	1685	0.298	0.254	MYOM1_HUMAN Myomesin-1 OS=Homo sapiens OX=9606 GN=MYOM1 PE=1 SV=2
11	P54296	0.0	1134	1465	0.406	0.399	MYOM2_HUMAN Myomesin-2 OS=Homo sapiens OX=9606 GN=MYOM2 PE=1 SV=3
12	Q14BI5	0.0	1137	1463	0.404	0.397	Q14BI5_MOUSE Myomesin 2 OS=Mus musculus OX=10090 GN=Myom2 PE=1 SV=1
13	Q3UQS9	0.0	1138	1463	0.404	0.397	Q3UQS9_MOUSE Myomesin-2 OS=Mus musculus OX=10090 GN=Myom2 PE=2 SV=1
14	Q5VTT5	0.0	2966	1437	1.000	1.000	MYOM3_HUMAN Myomesin-3 OS=Homo sapiens OX=9606 GN=MYOM3 PE=1 SV=1
15	Q62234	0.0	725	1667	0.301	0.260	MYOM1_MOUSE Myomesin-1 OS=Mus musculus OX=10090 GN=Myom1 PE=1 SV=2
16	A2ASS6	2.42e-69	261	35213	0.152	0.006	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
17	A0A8I5ZU83	8.62e-69	259	26931	0.152	0.008	A0A8I5ZU83_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
18	A0A8I5ZUN3	2.32e-68	258	35375	0.152	0.006	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
19	Q8WZ42	6.71e-68	257	34350	0.152	0.006	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
20	Q23551	1.21e-53	210	7158	0.107	0.022	UNC22_CAEEL Twitchin OS=Caenorhabditis elegans OX=6239 GN=unc-22 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	2	20.2	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	2e-05	35.9	CD80-like C2-set immunoglobulin domain
3	PF00041 fn3	6.7e-76	262.0	Fibronectin type III domain
4	PF16893 fn3_2	0.00033	32.1	Fibronectin type III domain
5	PF20418 Herpes_gE_N	80	14.5	Alphaherpesvirus glycoprotein E N-terminal
6	PF07679 I-set	2e-66	231.4	Immunoglobulin I-set domain
7	PF00047 ig	8.7e-32	120.5	Immunoglobulin domain
8	PF13895 Ig_2	1.7e-25	100.4	Immunoglobulin domain
9	PF13927 Ig_3	1.7e-43	158.4	Immunoglobulin domain
10	PF09134 Invasin_D3	24	16.8	Invasin, domain 3
11	PF16656 Pur_ac_phosph_N	0.0021	30.0	Purple acid Phosphatase, N-terminal domain
12	PF01108 Tissue_fac	3.3e-07	41.5	Tissue factor
13	PF07686 V-set	3.8e-16	70.6	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363557

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307280	0.665	Myosin light chain 1/3, skeletal muscle isoform
2	9606.ENSP00000299339	0.596	Claudin-10
3	9606.ENSP00000306997	0.564	Myozenin-2
4	9606.ENSP00000385636	0.519	Obscurin-like protein 1
5	9606.ENSP00000327145	0.508	Filamin-C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.697	identical protein binding
GO:0005198	0.392	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.990	multicellular organismal process
GO:0009987	0.882	cellular process
GO:0048856	0.788	anatomical structure development
GO:0003008	0.728	system process
GO:0003012	0.709	muscle system process
GO:0065007	0.604	biological regulation
GO:0006936	0.600	muscle contraction
GO:0050789	0.586	regulation of biological process
GO:0009653	0.466	anatomical structure morphogenesis
GO:0061061	0.451	muscle structure development
GO:0048513	0.400	animal organ development
GO:0071840	0.378	cellular component organization or biogenesis
GO:0016043	0.368	cellular component organization
GO:0007275	0.319	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030017	0.999	sarcomere
GO:0031672	0.977	A band
GO:0005856	0.869	cytoskeleton
GO:0031430	0.867	M band
GO:0005829	0.515	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]