StarFunc result for job id Q5VU43

User Input

>input (2346 residues)
MSNGYRTLSQHLNDLKKENFSLKLRIYFLEERMQQKYEASREDIYKRNIELKVEVESLKR
ELQDKKQHLDKTWADVENLNSQNEAELRRQFEERQQETEHVYELLENKIQLLQEESRLAK
NEAARMAALVEAEKECNLELSEKLKGVTKNWEDVPGDQVKPDQYTEALAQRDKRIEELNQ
SLAAQERLVEQLSREKQQLLHLLEEPTSMEVQPMTEELLKQQKLNSHETTITQQSVSDSH
LAELQEKIQQTEATNKILQEKLNEMSYELKCAQESSQKQDGTIQNLKETLKSRERETEEL
YQVIEGQNDTMAKLREMLHQSQLGQLHSSEGTSPAQQQVALLDLQSALFCSQLEIQKLQR
VVRQKERQLADAKQCVQFVEAAAHESEQQKEASWKHNQELRKALQQLQEELQNKSQQLRA
WEAEKYNEIRTQEQNIQHLNHSLSHKEQLLQEFRELLQYRDNSDKTLEANEMLLEKLRQR
IHDKAVALERAIDEKFSALEEKEKELRQLRLAVRERDHDLERLRDVLSSNEATMQSMESL
LRAKGLEVEQLSTTCQNLQWLKEEMETKFSRWQKEQESIIQQLQTSLHDRNKEVEDLSAT
LLCKLGPGQSEIAEELCQRLQRKERMLQDLLSDRNKQVLEHEMEIQGLLQSVSTREQESQ
AAAEKLVQALMERNSELQALRQYLGGRDSLMSQAPISNQQAEVTPTGRLGKQTDQGSMQI
PSRDDSTSLTAKEDVSIPRSTLGDLDTVAGLEKELSNAKEELELMAKKERESQMELSALQ
SMMAVQEEELQVQAADMESLTRNIQIKEDLIKDLQMQLVDPEDIPAMERLTQEVLLLREK
VASVESQGQEISGNRRQQLLLMLEGLVDERSRLNEALQAERQLYSSLVKFHAHPESSERD
RTLQVELEGAQVLRSRLEEVLGRSLERLNRLETLAAIGGAAAGDDTEDTSTEFTDSIEEE
AAHHSHQQLVKVALEKSLATVETQNPSFSPPSPMGGDSNRCLQEEMLHLRAEFHQHLEEK
RKAEEELKELKAQIEEAGFSSVSHIRNTMLSLCLENAELKEQMGEAMSDGWEIEEDKEKG
EVMVETVVTKEGLSESSLQAEFRKLQGKLKNAHNIINLLKEQLVLSSKEGNSKLTPELLV
HLTSTIERINTELVGSPGKHQHQEEGNVTVRPFPRPQSLDLGATFTVDAHQLDNQSQPRD
PGPQSAFSLPGSTQHLRSQLSQCKQRYQDLQEKLLLSEATVFAQANELEKYRVMLTGESL
VKQDSKQIQVDLQDLGYETCGRSENEAEREETTSPECEEHNSLKEMVLMEGLCSEQGRRG
STLASSSERKPLENQLGKQEEFRVYGKSENILVLRKDIKDLKAQLQNANKVIQNLKSRVR
SLSVTSDYSSSLERPRKLRAVGTLEGSSPHSVPDEDEGWLSDGTGAFYSPGLQAKKDLES
LIQRVSQLEAQLPKNGLEEKLAEELRSASWPGKYDSLIQDQARELSYLRQKIREGRGICY
LITRHAKDTVKSFEDLLRSNDIDYYLGQSFREQLAQGSQLTERLTSKLSTKDHKSEKDQA
GLEPLALRLSRELQEKEKVIEVLQAKLDARSLTPSSSHALSDSHRSPSSTSFLSDELEAC
SDMDIVSEYTHYEEKKASPSHSDSIHHSSHSAVLSSKPSSTSASQGAKAESNSNPISLPT
PQNTPKEANQAHSGFHFHSIPKLASLPQAPLPSAPSSFLPFSPTGPLLLGCCETPVVSLA
EAQQELQMLQKQLGESASTVPPASTATLLSNDLEADSSYYLNSAQPHSPPRGTIELGRIL
EPGYLGSSGKWDVMRPQKGSVSGDLSSGSSVYQLNSKPTGADLLEEHLGEIRNLRQRLEE
SICINDRLREQLEHRLTSTARGRGSTSNFYSQGLESIPQLCNENRVLREDNRRLQAQLSH
VSREHSQETESLREALLSSRSHLQELEKELEHQKVERQQLLEDLREKQQEVLHFREERLS
LQENDSRLQHKLVLLQQQCEEKQQLFESLQSELQIYEALYGNSKKGLKAYSLDACHQIPL
SSDLSHLVAEVRALRGQLEQSIQGNNCLRLQLQQQLESGAGKASLSPSSINQNFPASTDP
GNKQLLLQDSAVSPPVRDVGMNSPALVFPSSASSTPGSETPIINRANGLGLDTSPVMKTP
PKLEGDATDGSFANKHGRHVIGHIDDYSALRQQIAEGKLLVKKIVSLVRSACSFPGLEAQ
GTEVLGSKGIHELRSSTSALHHALEESASLLTMFWRAALPSTHIPVLPGKVGESTERELL
ELRTKVSKQERLLQSTTEHLKNANQQKESMEQFIVSQLTRTHDVLKKARTNLEVKSLRAL
PCTPAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VU43	1.000	1.000	0.000	2346	1.000	1.000	Q5VU43.pdb.gz	MYOME_HUMAN Myomegalin OS=Homo sapiens OX=9606 GN=PDE4DIP PE=1 SV=3
2	AFDB:Q80YT7	0.159	0.167	0.000	2224	0.770	0.812	Q80YT7.pdb.gz	MYOME_MOUSE Myomegalin OS=Mus musculus OX=10090 GN=Pde4dip PE=1 SV=2
3	AFDB:Q9JLH5	0.067	0.078	8.222E-29	1903	0.207	0.255	Q9JLH5.pdb.gz	CK5P2_RAT CDK5 regulatory subunit-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Cdk5rap2 PE=1 SV=2
4	AFDB:Q6VGS5	0.041	0.047	2.084E-12	2009	0.127	0.149	Q6VGS5.pdb.gz	DAPLE_MOUSE Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c PE=1 SV=1
5	AFDB:Q9P219	0.047	0.053	1.102E-11	2028	0.138	0.159	Q9P219.pdb.gz	DAPLE_HUMAN Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3
6	AFDB:P85120	0.056	0.064	1.170E-11	2058	0.139	0.158	P85120.pdb.gz	DAPLE_XENLA Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c PE=1 SV=1
7	AFDB:A1Z8P9	0.049	0.049	2.068E-9	2346	0.139	0.139	A1Z8P9.pdb.gz	TPR_DROME Nucleoprotein TPR OS=Drosophila melanogaster OX=7227 GN=Mtor PE=1 SV=1
8	AFDB:Q5SNZ0	0.054	0.065	6.032E-9	1873	0.125	0.157	Q5SNZ0.pdb.gz	GRDN_MOUSE Girdin OS=Mus musculus OX=10090 GN=Ccdc88a PE=1 SV=2
9	AFDB:Q585C9	0.048	0.081	8.121E-9	1271	0.091	0.168	Q585C9.pdb.gz	Q585C9_TRYB2 NUP-1 protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3A7.660 PE=4 SV=1
10	AFDB:I0J0E7	0.058	0.098	1.982E-8	1217	0.090	0.174	I0J0E7.pdb.gz	NMCP1_ALLCE Nuclear matrix constituent protein 1 OS=Allium cepa OX=4679 GN=NMCP1 PE=2 SV=1
11	PDB:5ew5A	0.036	0.163	4.801E-1	490	0.008	0.037	5ew5A.pdb.gz
12	PDB:2b5uA	0.023	0.092	6.091E-1	470	0.009	0.045	2b5uA.pdb.gz
13	PDB:2zdiB	0.030	0.435	6.464E-1	106	0.008	0.170	2zdiB.pdb.gz
14	PDB:7n6g3I	0.026	0.110	7.281E-1	401	0.019	0.110	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
15	PDB:7sqcO1	0.028	0.067	7.727E-1	673	0.017	0.061	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:6n8jb	0.020	0.052	1.040	647	0.019	0.068	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
17	PDB:6tuyA	0.034	0.101	1.104	667	0.005	0.018	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
18	PDB:6ylgb	0.021	0.055	1.104	613	0.018	0.069	6ylgb.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
19	PDB:7nsuD	0.035	0.183	1.172	420	0.009	0.048	7nsuD.pdb.gz
20	PDB:5n9jZ	0.032	0.423	1.320	119	0.005	0.101	5n9jZ.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7ZNY0	0.0	3649	2412	0.795	0.773	B7ZNY0_MOUSE Pde4dip protein OS=Mus musculus OX=10090 GN=Pde4dip PE=1 SV=1
2	Q5VU43	0.0	4736	2346	1.000	1.000	MYOME_HUMAN Myomegalin OS=Homo sapiens OX=9606 GN=PDE4DIP PE=1 SV=3
3	Q80YT7	0.0	3456	2224	0.764	0.806	MYOME_MOUSE Myomegalin OS=Mus musculus OX=10090 GN=Pde4dip PE=1 SV=2
4	Q9WUJ3	0.0	3505	2324	0.780	0.788	MYOME_RAT Myomegalin OS=Rattus norvegicus OX=10116 GN=Pde4dip PE=1 SV=1
5	Q8TBR0	7.03e-103	329	177	0.069	0.921	Q8TBR0_HUMAN PDE4DIP protein OS=Homo sapiens OX=9606 GN=PDE4DIP PE=1 SV=1
6	Q5JTU8	6.93e-46	183	903	0.077	0.199	Q5JTU8_HUMAN CDK5 regulatory subunit associated protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=CDK5RAP2 PE=1 SV=1
7	A0A0A0MRG9	1.02e-45	185	1663	0.077	0.108	A0A0A0MRG9_HUMAN CDK5 regulatory subunit-associated protein 2 OS=Homo sapiens OX=9606 GN=CDK5RAP2 PE=1 SV=1
8	Q96SN8	1.21e-45	185	1893	0.077	0.095	CK5P2_HUMAN CDK5 regulatory subunit-associated protein 2 OS=Homo sapiens OX=9606 GN=CDK5RAP2 PE=1 SV=5
9	B1AMJ5	3.38e-45	182	1287	0.077	0.140	B1AMJ5_HUMAN CDK5 regulatory subunit-associated protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=CDK5RAP2 PE=1 SV=1
10	Q9JLH5	6.32e-45	182	1903	0.072	0.088	CK5P2_RAT CDK5 regulatory subunit-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Cdk5rap2 PE=1 SV=2
11	Q8K389	1.03e-39	165	1822	0.064	0.082	CK5P2_MOUSE CDK5 regulatory subunit-associated protein 2 OS=Mus musculus OX=10090 GN=Cdk5rap2 PE=1 SV=3
12	A0A2K7P776	3.27e-09	65.1	867	0.025	0.067	A0A2K7P776_HUMAN NBPF9 isoform 1 OS=Homo sapiens OX=9606 PE=1 SV=1
13	P0DPF3	1.80e-08	62.8	1111	0.026	0.054	NBPF9_HUMAN Neuroblastoma breakpoint family member 9 OS=Homo sapiens OX=9606 GN=NBPF9 PE=2 SV=1
14	Q3BBV0	2.44e-08	62.4	1214	0.025	0.049	NBPF1_HUMAN Neuroblastoma breakpoint family member 1 OS=Homo sapiens OX=9606 GN=NBPF1 PE=1 SV=2
15	Q5TI25	9.74e-08	60.1	921	0.024	0.061	NBPFE_HUMAN Neuroblastoma breakpoint family member 14 OS=Homo sapiens OX=9606 GN=NBPF14 PE=2 SV=2
16	A0A087WUL8	4.87e-07	58.2	3843	0.022	0.014	NBPFJ_HUMAN Neuroblastoma breakpoint family member 19 OS=Homo sapiens OX=9606 GN=NBPF19 PE=5 SV=1
17	Q6P3W6	7.22e-07	57.8	3795	0.029	0.018	NBPFA_HUMAN Neuroblastoma breakpoint family member 10 OS=Homo sapiens OX=9606 GN=NBPF10 PE=3 SV=3
18	P07942	7.61e-05	50.8	1786	0.037	0.049	LAMB1_HUMAN Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2
19	P54623	3.15e-04	48.9	1320	0.026	0.046	CNN_DROME Centrosomin OS=Drosophila melanogaster OX=7227 GN=cnn PE=1 SV=3
20	F1MNT4	6.72e-04	47.8	1786	0.037	0.048	F1MNT4_BOVIN Laminin subunit beta 1 OS=Bos taurus OX=9913 GN=LAMB1 PE=4 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	19	16.9	Autophagy protein 16 (ATG16)
2	PF07989 Cnn_1N	1.8e-16	71.4	Centrosomin N-terminal motif 1
3	PF06758 Olduvai	1.1e-10	52.8	Olduvai domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358363

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348573	0.991	A-kinase anchor protein 9
2	9606.ENSP00000345502	0.922	cAMP-specific 3',5'-cyclic phosphodiesterase 4D
3	9606.ENSP00000364721	0.914	Microtubule-associated protein RP/EB family member 1
4	9606.ENSP00000343818	0.778	CDK5 regulatory subunit-associated protein 2
5	9606.ENSP00000233121	0.734	Microtubule-associated protein RP/EB family member 3
6	9606.ENSP00000408058	0.712	Alpha N-terminal protein methyltransferase 1B
7	9606.ENSP00000352572	0.695	Pericentrin
8	9606.ENSP00000265717	0.693	cAMP-dependent protein kinase type II-beta regulatory subunit
9	9606.ENSP00000359719	0.688	cAMP-dependent protein kinase catalytic subunit beta
10	9606.ENSP00000368540	0.688	Ubiquitin associated protein 2
11	9606.ENSP00000348959	0.676	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB
12	9606.ENSP00000261183	0.671	Oxysterol-binding protein-related protein 8
13	9606.ENSP00000349687	0.668	Ganglioside GM2 activator
14	9606.ENSP00000239461	0.660	Paired mesoderm homeobox protein 1
15	9606.ENSP00000380880	0.659	PQ-loop repeat-containing protein 1
16	9606.ENSP00000354560	0.658	Kinesin-associated protein 3
17	9606.ENSP00000309591	0.657	cAMP-dependent protein kinase catalytic subunit alpha
18	9606.ENSP00000318258	0.625	Cysteine/serine-rich nuclear protein 3
19	9606.ENSP00000321997	0.623	La-related protein 1B
20	9606.ENSP00000323300	0.622	Sperm-associated antigen 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0060090	0.921	molecular adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0051128	0.973	regulation of cellular component organization
GO:0007010	0.956	cytoskeleton organization
GO:0048522	0.955	positive regulation of cellular process
GO:0000226	0.942	microtubule cytoskeleton organization
GO:0044087	0.905	regulation of cellular component biogenesis
GO:0070507	0.884	regulation of microtubule cytoskeleton organization
GO:0010638	0.855	positive regulation of organelle organization
GO:1902903	0.851	regulation of supramolecular fiber organization
GO:0044089	0.845	positive regulation of cellular component biogenesis
GO:0031113	0.831	regulation of microtubule polymerization
GO:0051495	0.822	positive regulation of cytoskeleton organization
GO:0031112	0.789	positive regulation of microtubule polymerization or depolymerization
GO:0032273	0.750	positive regulation of protein polymerization
GO:0031116	0.711	positive regulation of microtubule polymerization
GO:0022402	0.691	cell cycle process
GO:0097435	0.365	supramolecular fiber organization
GO:0044085	0.329	cellular component biogenesis
GO:0022607	0.321	cellular component assembly
GO:0031122	0.309	cytoplasmic microtubule organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.999	Golgi apparatus
GO:0005813	0.999	centrosome
GO:0099080	0.995	supramolecular complex
GO:0099512	0.990	supramolecular fiber
GO:0071944	0.958	cell periphery
GO:0005829	0.945	cytosol
GO:0005874	0.714	microtubule
GO:1990752	0.690	microtubule end
GO:0005634	0.482	nucleus
GO:0031981	0.418	nuclear lumen
GO:0005654	0.390	nucleoplasm
GO:0005881	0.388	cytoplasmic microtubule
GO:0016020	0.382	membrane
GO:1903754	0.362	cortical microtubule plus-end

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]