StarFunc result for job id Q5VU65

User Input

>input (1888 residues)
MTGCPASSRRRGFGLFFFLRLHRLLLLFLVLRGTLANKLNVPQVLLPFGREPGRVPFLLE
AQRGCYTWHSTHHDAVTVEPLYENGTLCSQKAVLIAESTQPIRLSSIILAREIVTDHELR
CDVKVDVINSIEIVSRARELYVDDSPLELMVRALDAEGNTFSSLAGMMFEWSIAQDNESA
REELSSKIRILKYSEAEYAPPIYIAEMEKEEKQGDVILVSGIRTGAAVVKVRIHEPFYKK
VAAALIRLLVLENIFLIPSHDIYLLVGTYIKYQVAKMVQGRVTEVKFPLEHYILELQDHR
VALNGSHSEKVAILDDKTAMVTASQLGQTNLVFVHKNVHMRSVSGLPNCTIYVVEPGFLG
FTVQPGNRWSLEVGQVYVITVDVFDKSSTKVYISDNLRITYDFPKEYFEEQLTTVNGSYH
IVKALKDGVVVINASLTSIIYQNKDIQPIKFLIKHQQEVKIYFPIMLTPKFLAFPHHPMG
MLYRYKVQVEGGSGNFTWTSSNETVVIVTTKGVVTAGQVRGNSTVLARDVQNPFRYGEIK
IHVLKLNKMELLPFHADVEIGQIIEIPIAMYHINKETKEAMAFTDCSHLSLDLNMDKQGV
FTLLKEGIQRPGPMHCSSTHIAAKSLGHTLVTVSVNECDKYLESSATFAAYEPLKALNPV
EVALVTWQSVKEMVFEGGPRPWILEPSRFFLELNAEKTEKIGIAQVWLPSKRKQNQYIYR
IQCLDLGEQVLTFRIGNHPGVLNPSPAVEVLQVRFICAHPASMSVTPVYKVPAGAQPCPL
PQHNKWLIPVSRLRDTVLELAVFDQHRRKFDNFSSLMLEWKSSNETLAHFEDYKSVEMVA
KDDGSGQTRLHGHQILKVHQIKGTVLIGVNFVGYSEKKSPKEISNLPRSVDVELLLVDDV
TVVPENATIYNHPDVKETFSLVEGSGYFLVNSSEQGVVTITYMEAESSVELVPLHPGFFT
LEVYDLCLAFLGPATAHLRVSDIQELELDLIDKVEIDKTVLVTVRVLGSSKRPFQNKYFR
NMELKLQLASAIVTLTPMEQQDEYSENYILRATTIGQTTLVAIAKDKMGRKYTSTPRHIE
VFPPFRLLPEKMTLIPMNMMQVMSEGGPQPQSIVHFSISNQTVAVVNRRGQVTGKIVGTA
VVHGTIQTVNEDTGKVIVFSQDEVQIEVVQLRAVRILAAATRLITATKMPVYVMGVTSTQ
TPFSFSNANPGLTFHWSMSKRDVLDLVPRHSEVFLQLPVEHNFAMVVHTKAAGRTSIKVT
VHCMNSSSGQFEGNLLELSDEVQILVFEKLQLFYPECQPEQILMPINSQLKLHTNREGAA
FVSSRVLKCFPNSSVIEEDGEGLLKAGSIAGTAVLEVTSIEPFGVNQTTITGVQVAPVTY
LRVSSQPKLYTAQGRTLSAFPLGMSLTFTVQFYNSIGEKFHTHNTQLYLALNRDDLLHIG
PGNKNYTYMAQAVNRGLTLVGLWDRRHPGMADYIPVAVEHAIEPDTKLTFVGDIICFSTH
LVSQHGEPGIWMISANNILQTDIVTGVGVARSPGTAMIFHDIPGVVKTYREVVVNASSRL
MLSYDLKTYLTNTLNSTVFKLFITTGRNGVNLKGFCTPNQALAITKVLLPATLMLCHVQF
SNTLLDIPASKVFQVHSDFSMEKGVYVCIIKVRPQSEELLQALSVADTSVYGWATLVSER
SKNGMQRILIPFIPAFYINQSELVLSHKQDIGEIRVLGVDRVLRKLEVISSSPVLVVAGH
SHSPLTPGLAIYSVRVVNFTSFQQMASPVFINISCVLTSQSEAVVVRAMKDKLGADHCED
SAILKRFTGSYQILLLTLFAVLASTASIFLAYNAFLNKIQTVPVVYVPTLGTPQPGFFNS
TSSPPHFMSLQPPLAQSRLQHWLWSIRH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1Z6H7	0.325	0.327	0.000	1876	0.216	0.217	A1Z6H7.pdb.gz	PO210_DROME Nuclear pore membrane glycoprotein 210 OS=Drosophila melanogaster OX=7227 GN=Gp210 PE=1 SV=1
2	AFDB:F4KHD8	0.422	0.416	0.000	1923	0.207	0.203	F4KHD8.pdb.gz	GP210_ARATH Nuclear pore complex protein GP210 OS=Arabidopsis thaliana OX=3702 GN=GB210 PE=1 SV=1
3	AFDB:P11654	0.407	0.408	0.000	1886	0.435	0.435	P11654.pdb.gz	PO210_RAT Nuclear pore membrane glycoprotein 210 OS=Rattus norvegicus OX=10116 GN=Nup210 PE=1 SV=1
4	AFDB:P91495	0.360	0.367	0.000	1847	0.232	0.237	P91495.pdb.gz	P91495_CAEEL BIG2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=npp-12 PE=1 SV=1
5	AFDB:Q54IS9	0.341	0.337	0.000	1916	0.228	0.225	Q54IS9.pdb.gz	Q54IS9_DICDI Nucleoporin 210 OS=Dictyostelium discoideum OX=44689 GN=nup210 PE=3 SV=1
6	AFDB:Q8TEM1	0.378	0.378	0.000	1887	0.449	0.449	Q8TEM1.pdb.gz	PO210_HUMAN Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3
7	AFDB:Q9D2F7	0.428	0.430	0.000	1881	0.826	0.829	Q9D2F7.pdb.gz	P210L_MOUSE Nuclear pore membrane glycoprotein 210-like OS=Mus musculus OX=10090 GN=Nup210l PE=1 SV=2
8	AFDB:A0A2R8QL08	0.091	0.086	6.275E-35	2036	0.110	0.102	A0A2R8QL08.pdb.gz
9	AFDB:Q6UVK1	0.085	0.076	1.529E-32	2322	0.109	0.089	Q6UVK1.pdb.gz	CSPG4_HUMAN Chondroitin sulfate proteoglycan 4 OS=Homo sapiens OX=9606 GN=CSPG4 PE=1 SV=2
10	AFDB:Q9VAF5	0.061	0.064	2.827E-27	1706	0.092	0.102	Q9VAF5.pdb.gz	CAD99_DROME Cadherin-99C OS=Drosophila melanogaster OX=7227 GN=Cad99C PE=1 SV=2
11	PDB:7sqcO0	0.083	0.121	1.131E-18	1140	0.054	0.089	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:5a42A	0.084	0.094	2.597E-17	1597	0.073	0.086	5a42A.pdb.gz
13	PDB:4aq1A	0.083	0.164	2.005E-16	721	0.044	0.115	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
14	PDB:7q1yA	0.082	0.100	6.508E-13	1374	0.051	0.071	7q1yA.pdb.gz
15	PDB:1e07A	0.083	0.209	8.167E-13	642	0.033	0.097	1e07A.pdb.gz
16	PDB:5oj2B	0.090	0.175	1.073E-12	692	0.041	0.111	5oj2B.pdb.gz
17	PDB:7vonA	0.078	0.099	1.543E-12	1399	0.053	0.071	7vonA.pdb.gz
18	PDB:4ziqA	0.071	0.083	6.905E-12	1450	0.059	0.077	4ziqA.pdb.gz
19	PDB:7nycA	0.093	0.108	4.869E-11	1542	0.055	0.067	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:7q5zA	0.080	0.104	1.103E-10	1344	0.047	0.065	7q5zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P11654	0.0	1538	1886	0.433	0.434	PO210_RAT Nuclear pore membrane glycoprotein 210 OS=Rattus norvegicus OX=10116 GN=Nup210 PE=1 SV=1
2	Q8TEM1	0.0	1532	1887	0.445	0.445	PO210_HUMAN Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3
3	Q9D2F7	0.0	3258	1881	0.827	0.830	P210L_MOUSE Nuclear pore membrane glycoprotein 210-like OS=Mus musculus OX=10090 GN=Nup210l PE=1 SV=2
4	Q9QY81	0.0	1511	1886	0.436	0.437	PO210_MOUSE Nuclear pore membrane glycoprotein 210 OS=Mus musculus OX=10090 GN=Nup210 PE=1 SV=2
5	P91495	4.63e-113	401	1847	0.235	0.240	P91495_CAEEL BIG2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=npp-12 PE=1 SV=1
6	Q54IS9	1.76e-112	400	1916	0.220	0.217	Q54IS9_DICDI Nucleoporin 210 OS=Dictyostelium discoideum OX=44689 GN=nup210 PE=3 SV=1
7	A1Z6H7	8.13e-93	337	1876	0.242	0.244	PO210_DROME Nuclear pore membrane glycoprotein 210 OS=Drosophila melanogaster OX=7227 GN=Gp210 PE=1 SV=1
8	F4KHD8	8.46e-55	214	1923	0.200	0.197	GP210_ARATH Nuclear pore complex protein GP210 OS=Arabidopsis thaliana OX=3702 GN=GB210 PE=1 SV=1
9	P70124	0.79	36.6	375	0.021	0.104	SPB5_MOUSE Serpin B5 OS=Mus musculus OX=10090 GN=Serpinb5 PE=1 SV=1
10	Q9Y2I1	6.8	34.3	1504	0.011	0.013	NISCH_HUMAN Nischarin OS=Homo sapiens OX=9606 GN=NISCH PE=1 SV=3
11	C9J715	7.5	33.9	583	0.010	0.033	C9J715_HUMAN Nischarin OS=Homo sapiens OX=9606 GN=NISCH PE=1 SV=1
12	Q80TM9	7.6	33.9	1593	0.008	0.010	NISCH_MOUSE Nischarin OS=Mus musculus OX=10090 GN=Nisch PE=1 SV=2
13	Q4G017	7.9	33.9	1502	0.008	0.011	NISCH_RAT Nischarin OS=Rattus norvegicus OX=10116 GN=Nisch PE=2 SV=2
14	Q9ULJ7	8.4	33.9	1429	0.020	0.027	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
15	Q8RY95	8.9	33.9	1035	0.013	0.023	SPL14_ARATH Squamosa promoter-binding-like protein 14 OS=Arabidopsis thaliana OX=3702 GN=SPL14 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02368 Big_2	1.4e-07	42.7	Bacterial Ig-like domain (group 2)
2	PF08923 MAPKK1_Int	4.6e+02	12.0	Mitogen-activated protein kinase kinase 1 interacting
3	PF13629 T2SS-T3SS_pil_N	71	14.5	Pilus formation protein N terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357547

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229179	0.884	Nuclear pore complex protein Nup107
2	9606.ENSP00000316032	0.879	Nuclear pore complex protein Nup98-Nup96
3	9606.ENSP00000295119	0.872	Nucleoporin NUP53
4	9606.ENSP00000367721	0.867	Nuclear pore complex protein Nup160
5	9606.ENSP00000254508	0.808	Nuclear pore membrane glycoprotein 210
6	9606.ENSP00000369461	0.788	Enoyl-CoA delta isomerase 2, mitochondrial
7	9606.ENSP00000310668	0.728	Nuclear pore complex protein Nup93
8	9606.ENSP00000312734	0.714	Ras-related protein Rab-8B
9	9606.ENSP00000231498	0.708	Nuclear pore complex protein Nup155
10	9606.ENSP00000357564	0.702	Ras-related protein Rab-13
11	9606.ENSP00000271732	0.699	Golgi phosphoprotein 3-like
12	9606.ENSP00000285968	0.673	Nuclear pore complex protein Nup205
13	9606.ENSP00000361544	0.653	Nucleoporin-62 C-terminal-like protein
14	9606.ENSP00000360824	0.642	Uncharacterized protein C1orf185
15	9606.ENSP00000352400	0.621	Nuclear pore complex protein Nup214
16	9606.ENSP00000264883	0.611	Nucleoporin p54
17	9606.ENSP00000352157	0.607	Mitogen-activated protein kinase 10
18	9606.ENSP00000290231	0.585	Nuclear receptor coactivator 5
19	9606.ENSP00000444029	0.579	Nuclear pore complex protein Nup153
20	9606.ENSP00000349612	0.573	Ankyrin repeat domain-containing protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0048856	0.926	anatomical structure development
GO:0019953	0.841	sexual reproduction
GO:0003006	0.838	developmental process involved in reproduction
GO:0007275	0.803	multicellular organism development
GO:0007548	0.785	sex differentiation
GO:0045137	0.779	development of primary sexual characteristics
GO:0007283	0.751	spermatogenesis
GO:0046546	0.746	development of primary male sexual characteristics
GO:0048731	0.742	system development
GO:0008406	0.734	gonad development
GO:0008584	0.700	male gonad development
GO:0048515	0.688	spermatid differentiation
GO:0007281	0.664	germ cell development
GO:0009888	0.610	tissue development
GO:0071840	0.397	cellular component organization or biogenesis
GO:0030855	0.384	epithelial cell differentiation
GO:0007286	0.384	spermatid development
GO:0016043	0.355	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005635	1.000	nuclear envelope
GO:0005737	0.947	cytoplasm
GO:0070013	0.910	intracellular organelle lumen
GO:0032991	0.896	protein-containing complex
GO:0016020	0.796	membrane
GO:0005643	0.736	nuclear pore
GO:0031981	0.556	nuclear lumen
GO:0005829	0.534	cytosol
GO:0043232	0.307	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]