StarFunc result for job id Q5VU92

User Input

>input (463 residues)
MAQQQTGSRKRKAPAVEADAESSPSQGLAAADGEGPLLLKRQRRPATYRSMAHYLKVREV
GGWGPARLQGFDGELRGYAVQRLPELLTERQLELGTVNKVFASQWLNSRQVVCGTKCNTL
FVVDVESGHIARIPLLRDSEARLAQDQQGCGIHAIELNPSKTLLATGGENPNSLAIYQLP
SLDPLCLGDRHGHKDWIFAVAWLSDTVAVSGSRDGTVALWRMDPDKFDDTVAWHSEVGLP
VYAHIRPRDVEAIPRAIINPSNRKVRALACGGKNQELGAVSLDGYFHLWKAGSALSRLLS
IRLPYFRDNVCLTYCDDMSVYAVGSHSHVSFLDLRQDQQNIRPLCSREGGTGVRSLSFYR
HIITVGTGQGSLLFYDVRAQKFLEERASATLESSSGPARRKLRLACGRGWLNHNDFWVNY
FGGMEVFPNALYTHCYNWPEMKLFVAGGPLPAGLHGNYAGLWS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VU92	1.000	1.000	3.261E-89	463	1.000	1.000	Q5VU92.pdb.gz	DC121_HUMAN DDB1- and CUL4-associated factor 12-like protein 1 OS=Homo sapiens OX=9606 GN=DCAF12L1 PE=1 SV=1
2	AFDB:Q5T6F0	0.822	0.840	5.438E-59	453	0.611	0.625	Q5T6F0.pdb.gz	DCA12_HUMAN DDB1- and CUL4-associated factor 12 OS=Homo sapiens OX=9606 GN=DCAF12 PE=1 SV=1
3	PDB:8ajmB	0.783	0.913	1.677E-49	395	0.568	0.666	8ajmB.pdb.gz	Recognition of the CCT5 di-Glu degron by CRL4 DCAF12 is dependent on TRiC assembly.
4	AFDB:Q9VGE3	0.722	0.728	1.006E-39	459	0.359	0.362	Q9VGE3.pdb.gz	DCA12_DROME DDB1- and CUL4-associated factor 12 homolog OS=Drosophila melanogaster OX=7227 GN=DCAF12 PE=1 SV=2
5	AFDB:Q8MSW9	0.566	0.544	2.875E-14	484	0.162	0.155	Q8MSW9.pdb.gz	Q8MSW9_DROME LD17611p OS=Drosophila melanogaster OX=7227 GN=U3-55K PE=1 SV=1
6	PDB:7jvrB	0.536	0.709	5.683E-14	342	0.140	0.190	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
7	AFDB:Q9NW82	0.538	0.393	6.961E-14	654	0.149	0.106	Q9NW82.pdb.gz	WDR70_HUMAN WD repeat-containing protein 70 OS=Homo sapiens OX=9606 GN=WDR70 PE=1 SV=1
8	AFDB:Q8VBV4	0.502	0.344	1.299E-13	710	0.164	0.107	Q8VBV4.pdb.gz	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2
9	AFDB:Q676U5	0.502	0.389	1.519E-13	607	0.143	0.109	Q676U5.pdb.gz	A16L1_HUMAN Autophagy-related protein 16-1 OS=Homo sapiens OX=9606 GN=ATG16L1 PE=1 SV=2
10	AFDB:Q9SK69	0.555	0.405	1.775E-13	648	0.162	0.116	Q9SK69.pdb.gz	Q9SK69_ARATH At2g20330/F11A3.12 OS=Arabidopsis thaliana OX=3702 GN=At2g20330 PE=1 SV=1
11	AFDB:Q6ZMY6	0.551	0.541	2.835E-13	472	0.145	0.142	Q6ZMY6.pdb.gz	WDR88_HUMAN WD repeat-containing protein 88 OS=Homo sapiens OX=9606 GN=WDR88 PE=1 SV=2
12	PDB:7mq8LR	0.560	0.343	2.850E-13	773	0.108	0.065	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	AFDB:Q389W0	0.495	0.514	4.080E-13	444	0.166	0.173	Q389W0.pdb.gz	Q389W0_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0110 PE=3 SV=1
14	PDB:5mzhB	0.496	0.548	5.319E-13	415	0.097	0.108	5mzhB.pdb.gz
15	PDB:6ttuT	0.539	0.627	8.064E-13	394	0.132	0.155	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
16	PDB:7pzyh	0.535	0.776	8.064E-13	311	0.114	0.170	7pzyh.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
17	PDB:5a2qg	0.488	0.692	2.282E-12	314	0.123	0.182	5a2qg.pdb.gz	Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
18	PDB:5nnzA	0.502	0.667	2.282E-12	335	0.110	0.152	5nnzA.pdb.gz
19	PDB:7ad3F	0.514	0.726	3.459E-12	318	0.147	0.214	7ad3F.pdb.gz	Structure of the class D GPCR Ste2 dimer coupled to two G proteins.
20	PDB:2h9lA	0.523	0.736	4.978E-12	321	0.099	0.143	2h9lA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T6F0	0.0	560	453	0.616	0.629	DCA12_HUMAN DDB1- and CUL4-associated factor 12 OS=Homo sapiens OX=9606 GN=DCAF12 PE=1 SV=1
2	Q5VU92	0.0	956	463	1.000	1.000	DC121_HUMAN DDB1- and CUL4-associated factor 12-like protein 1 OS=Homo sapiens OX=9606 GN=DCAF12L1 PE=1 SV=1
3	Q9VGE3	2.16e-92	289	459	0.356	0.359	DCA12_DROME DDB1- and CUL4-associated factor 12 homolog OS=Drosophila melanogaster OX=7227 GN=DCAF12 PE=1 SV=2
4	Q09150	3.64e-04	44.7	302	0.073	0.113	REC14_SCHPO Meiotic recombination protein rec14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rec14 PE=1 SV=1
5	O94365	0.001	43.9	494	0.080	0.075	UTP15_SCHPO U3 small nucleolar RNA-associated protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=utp15 PE=3 SV=1
6	Q9AV81	0.002	42.7	527	0.054	0.047	PRP19_ORYSJ Pre-mRNA-processing factor 19 OS=Oryza sativa subsp. japonica OX=39947 GN=PRP19 PE=2 SV=1
7	P97499	0.004	42.4	2629	0.052	0.009	TEP1_MOUSE Telomerase protein component 1 OS=Mus musculus OX=10090 GN=Tep1 PE=1 SV=1
8	A0A0B4KEU5	0.010	40.8	534	0.134	0.116	A0A0B4KEU5_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
9	A0A0B4KEJ7	0.013	40.4	535	0.134	0.116	A0A0B4KEJ7_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
10	Q7JVY0	0.013	40.4	528	0.134	0.117	Q7JVY0_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
11	Q62623	0.018	40.0	499	0.089	0.082	CDC20_RAT Cell division cycle protein 20 homolog OS=Rattus norvegicus OX=10116 GN=Cdc20 PE=1 SV=2
12	O08653	0.019	40.0	2629	0.048	0.008	TEP1_RAT Telomerase protein component 1 OS=Rattus norvegicus OX=10116 GN=Tep1 PE=1 SV=1
13	Q9JJ66	0.020	39.7	499	0.089	0.082	CDC20_MOUSE Cell division cycle protein 20 homolog OS=Mus musculus OX=10090 GN=Cdc20 PE=1 SV=2
14	A8K3F6	0.021	39.3	340	0.130	0.176	A8K3F6_HUMAN cDNA FLJ77654, highly similar to Homo sapiens guanine nucleotide binding protein (G protein), beta polypeptide 4 (GNB4), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
15	Q9HAV0	0.031	38.9	340	0.127	0.174	GBB4_HUMAN Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens OX=9606 GN=GNB4 PE=1 SV=3
16	Q9FKT5	0.057	38.1	315	0.104	0.152	THOC3_ARATH THO complex subunit 3 OS=Arabidopsis thaliana OX=3702 GN=THO3 PE=1 SV=1
17	Q99973	0.073	38.1	2627	0.050	0.009	TEP1_HUMAN Telomerase protein component 1 OS=Homo sapiens OX=9606 GN=TEP1 PE=1 SV=2
18	Q12834	0.074	37.7	499	0.080	0.074	CDC20_HUMAN Cell division cycle protein 20 homolog OS=Homo sapiens OX=9606 GN=CDC20 PE=1 SV=2
19	Q4Q7Y7	0.085	37.4	312	0.056	0.083	Q4Q7Y7_LEIMA Small ribosomal subunit protein RACK1 OS=Leishmania major OX=5664 GN=LACK2 PE=2 SV=1
20	O60907	0.14	37.0	577	0.060	0.049	TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens OX=9606 GN=TBL1X PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20426 NBCH_WD40	81	13.5	Neurobeachin beta propeller domain
2	PF00400 WD40	0.032	26.3	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360167

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405222	0.834	DDB1- and CUL4-associated factor 8-like protein 1
2	9606.ENSP00000462745	0.802	DDB1- and CUL4-associated factor 8-like protein 2
3	9606.ENSP00000384109	0.755	Cullin-4B
4	9606.ENSP00000301764	0.716	DNA damage-binding protein 1
5	9606.ENSP00000364589	0.690	Cullin-4A
6	9606.ENSP00000356814	0.681	DDB1- and CUL4-associated factor 6
7	9606.ENSP00000252015	0.668	Short transient receptor potential channel 4-associated protein
8	9606.ENSP00000353128	0.667	DDB1- and CUL4-associated factor 12-like protein 2
9	9606.ENSP00000341351	0.642	DDB1- and CUL4-associated factor 5
10	9606.ENSP00000471242	0.642	FERM, ARHGEF and pleckstrin domain-containing protein 1
11	9606.ENSP00000415556	0.625	DDB1- and CUL4-associated factor 11
12	9606.ENSP00000351147	0.611	DDB1- and CUL4-associated factor 4
13	9606.ENSP00000317971	0.610	WD and tetratricopeptide repeats protein 1
14	9606.ENSP00000477695	0.601	Ankyrin repeat domain-containing protein 20A1
15	9606.ENSP00000256996	0.588	DNA damage-binding protein 2
16	9606.ENSP00000355958	0.581	Denticleless protein homolog
17	9606.ENSP00000360497	0.569	RING finger protein 113A
18	9606.ENSP00000357052	0.568	DDB1- and CUL4-associated factor 8
19	9606.ENSP00000393183	0.568	DDB1- and CUL4-associated factor 1
20	9606.ENSP00000451235	0.568	DDB1- and CUL4-associated factor 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0009987	0.996	cellular process
GO:0044238	0.994	primary metabolic process
GO:0043170	0.994	macromolecule metabolic process
GO:0050789	0.991	regulation of biological process
GO:0006807	0.990	nitrogen compound metabolic process
GO:0044237	0.989	cellular metabolic process
GO:1901564	0.978	organonitrogen compound metabolic process
GO:0050794	0.975	regulation of cellular process
GO:0051603	0.972	proteolysis involved in protein catabolic process
GO:0044260	0.954	cellular macromolecule metabolic process
GO:0044265	0.929	cellular macromolecule catabolic process
GO:0019941	0.923	modification-dependent protein catabolic process
GO:0006511	0.858	ubiquitin-dependent protein catabolic process
GO:0010498	0.774	proteasomal protein catabolic process
GO:0043161	0.729	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0019222	0.643	regulation of metabolic process
GO:0031323	0.506	regulation of cellular metabolic process
GO:0009894	0.467	regulation of catabolic process
GO:0031329	0.326	regulation of cellular catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0080008	0.999	Cul4-RING E3 ubiquitin ligase complex
GO:0005737	0.996	cytoplasm
GO:0043232	0.989	intracellular non-membrane-bounded organelle
GO:0043231	0.980	intracellular membrane-bounded organelle
GO:0005654	0.972	nucleoplasm
GO:0005856	0.562	cytoskeleton
GO:0016020	0.527	membrane
GO:0015630	0.455	microtubule cytoskeleton
GO:0005815	0.335	microtubule organizing center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]