StarFunc result for job id Q5VU97

User Input

>input (1274 residues)
MARQPEEEETAVARARRPPLWLLCLVACWLLGAGAEADFSILDEAQVLASQMRRLAAEEL
GVVTMQRIFNSFVYTEKISNGESEVQQLAKKIREKFNRYLDVVNRNKQVVEASYTAHLTS
PLTAIQDCCTIPPSMMEFDGNFNTNVSRTISCDRLSTTVNSRAFNPGRDLNSVLADNLKS
NPGIKWQYFSSEEGIFTVFPAHKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVT
DTQLQIAKDAAQVILSAIDEHDKISVLTVADTVRTCSLDQCYKTFLSPATSETKRKMSTF
VSSVKSSDSPTQHAVGFQKAFQLIRSTNNNTKFQANTDMVIIYLSAGITSKDSSEEDKKA
TLQVINEENSFLNNSVMILTYALMNDGVTGLKELAFLRDLAEQNSGKYGVPDRMALPVIK
GSMMVLNQLSNLETTVGRFYTNLPNRMIDEAVFSLPFSDEMGDGLIMTVSKPCYFGNLLL
GIVGVDVNLAYILEDVTYYQDSLASYTFLIDDKGYTLMHPSLTRPYLLSEPPLHTDIIHY
ENIPKFELVRQNILSLPLGSQIIAVPVNSSLSWHINKLRETGKEAYNVSYAWKMVQDTSF
ILCIVVIQPEIPVKQLKNLNTVPSSKLLYHRLDLLGQPSACLHFKQLATLESPTIMLSAG
SFSSPYEHLSQPETKRMVEHYTAYLSDNTRLIANPGLKFSVRNEVMATSHVTDEWMTQME
MSSLNTYIVRRYIATPNGVLRIYPGSLMDKAFDPTRRQWYLHAVANPGLISLTGPYLDVG
GAGYVVTISHTIHSSSTQLSSGHTVAVMGIDFTLRYFYKVLMDLLPVCNQDGGNKIRCFI
MEDRGYLVAHPTLIDPKGHAPVEQQHITHKEPLVANDILNHPNFVKKNLCNSFSDRTVQR
FYKFNTSLAGDLTNLVHGSHCSKYRLARIPGTNAFVGIVNETCDSLAFCACSMVDRLCLN
CHRMEQNECECPCECPLEVNECTGNLTNAENRNPSCEVHQEPVTYTAIDPGLQDALHQCV
NSRCSQRLESGDCFGVLDCEWCMVDSDGKTHLDKPYCAPQKECFGGIVGAKSPYVDDMGA
IGDEVITLNMIKSAPVGPVAGGIMGCIMVLVLAVYAYRHQIHRRSHQHMSPLAAQEMSVR
MSNLENDRDERDDDSHEDRGIISNTRFIAAVIERHAHSPERRRRYWGRSGTESDHGYSTM
SPQEDSENPPCNNDPLSAGVDVGNHDEDLDLDTPPQTAALLSHKFHHYRSHHPTLHHSHH
LQAAVTVHTVDAEC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6jp8F	0.521	0.664	1.315E-42	973	0.131	0.172	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
2	PDB:4nehA	0.125	0.144	7.385E-8	1084	0.072	0.085	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
3	PDB:4nenA	0.127	0.148	2.158E-7	1063	0.067	0.080	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
4	PDB:2xwbF	0.123	0.203	8.249E-7	714	0.053	0.095	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
5	PDB:5y58A	0.129	0.273	7.436E-6	548	0.034	0.078	5y58A.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres
6	PDB:6zheC	0.120	0.201	1.493E-5	705	0.044	0.079	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
7	PDB:7k0yC	0.127	0.229	1.952E-5	655	0.024	0.046	7k0yC.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.
8	PDB:6gvwD	0.120	0.516	4.136E-5	239	0.020	0.105	6gvwD.pdb.gz	Structural Basis of BRCC36 Function in DNA Repair and Immune Regulation.
9	PDB:6orbA	0.122	0.051	4.136E-5	3352	0.027	0.010	6orbA.pdb.gz
10	PDB:6sn1B	0.135	0.302	7.461E-5	503	0.035	0.087	6sn1B.pdb.gz
11	AFDB:Q9Y2N7	0.054	0.094	3.664E-1	669	0.053	0.102	Q9Y2N7.pdb.gz	HIF3A_HUMAN Hypoxia-inducible factor 3-alpha OS=Homo sapiens OX=9606 GN=HIF3A PE=1 SV=2
12	AFDB:O54943	0.054	0.055	4.303E-1	1257	0.040	0.041	O54943.pdb.gz	PER2_MOUSE Period circadian protein homolog 2 OS=Mus musculus OX=10090 GN=Per2 PE=1 SV=3
13	AFDB:G5EE12	0.031	0.047	4.790E-1	678	0.025	0.047	G5EE12.pdb.gz	G5EE12_CAEEL Striatin N-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cash-1 PE=1 SV=1
14	AFDB:O15055	0.054	0.054	5.054E-1	1255	0.042	0.043	O15055.pdb.gz	PER2_HUMAN Period circadian protein homolog 2 OS=Homo sapiens OX=9606 GN=PER2 PE=1 SV=2
15	AFDB:P07663	0.049	0.050	5.054E-1	1224	0.039	0.041	P07663.pdb.gz	PER_DROME Period circadian protein OS=Drosophila melanogaster OX=7227 GN=per PE=1 SV=2
16	AFDB:D4A8G3	0.043	0.153	5.626E-1	239	0.029	0.155	D4A8G3.pdb.gz	LURA1_RAT Leucine rich adaptor protein 1 OS=Rattus norvegicus OX=10116 GN=Lurap1 PE=1 SV=1
17	AFDB:A0A2R8RS90	0.040	0.127	9.619E-1	286	0.025	0.112	A0A2R8RS90.pdb.gz
18	AFDB:Q54CD2	0.035	0.059	1.071	716	0.034	0.060	Q54CD2.pdb.gz	Q54CD2_DICDI Kelch repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293044 PE=4 SV=1
19	AFDB:E9QA62	0.040	0.074	1.130	571	0.024	0.053	E9QA62.pdb.gz	LMOD3_MOUSE Leiomodin-3 OS=Mus musculus OX=10090 GN=Lmod3 PE=1 SV=1
20	AFDB:Q95PZ0	0.033	0.083	1.130	426	0.016	0.049	Q95PZ0.pdb.gz	CSN6_CAEEL COP9 signalosome complex subunit 6 OS=Caenorhabditis elegans OX=6239 GN=csn-6 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PHS9	1.05e-20	101	1154	0.139	0.153	CA2D2_MOUSE Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Mus musculus OX=10090 GN=Cacna2d2 PE=1 SV=1
2	Q9NY47	1.33e-20	101	1150	0.096	0.106	CA2D2_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Homo sapiens OX=9606 GN=CACNA2D2 PE=1 SV=2
3	E7F4T2	1.67e-20	100	1091	0.102	0.119	E7F4T2_DANRE Calcium channel, voltage-dependent, alpha 2/delta subunit 1a OS=Danio rerio OX=7955 GN=si:ch211-251k4.1 PE=1 SV=2
4	Q8CFG6	2.52e-20	100	1157	0.130	0.143	CA2D2_RAT Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Rattus norvegicus OX=10116 GN=Cacna2d2 PE=2 SV=1
5	Q5TZ68	4.09e-20	99.8	1069	0.100	0.120	Q5TZ68_DANRE Calcium channel, voltage-dependent, alpha 2/delta subunit 1a OS=Danio rerio OX=7955 GN=si:ch211-251k4.1 PE=1 SV=2
6	Q8CFG5	4.46e-19	96.3	1085	0.092	0.108	CA2D3_RAT Voltage-dependent calcium channel subunit alpha-2/delta-3 OS=Rattus norvegicus OX=10116 GN=Cacna2d3 PE=1 SV=1
7	X2J9Z3	6.68e-18	92.4	1271	0.089	0.089	X2J9Z3_DROME Stolid, isoform H OS=Drosophila melanogaster OX=7227 GN=stol PE=1 SV=1
8	Q8IP22	7.18e-18	92.4	1215	0.077	0.081	Q8IP22_DROME Ca[2+] channel Muscle-specific alpha2/delta subunit, isoform A OS=Drosophila melanogaster OX=7227 GN=Ca-Ma2d PE=2 SV=2
9	P54289	6.59e-17	89.4	1103	0.126	0.146	CA2D1_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Homo sapiens OX=9606 GN=CACNA2D1 PE=1 SV=3
10	P13806	1.10e-16	88.6	1106	0.147	0.169	CA2D1_RABIT Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Oryctolagus cuniculus OX=9986 GN=CACNA2D1 PE=1 SV=1
11	P54290	2.73e-16	87.0	1091	0.139	0.162	CA2D1_RAT Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Rattus norvegicus OX=10116 GN=Cacna2d1 PE=1 SV=1
12	Q7K0H4	4.66e-16	86.3	1218	0.140	0.146	Q7K0H4_DROME SD07723p OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
13	Q7Z3S7	9.29e-16	85.5	1137	0.078	0.088	CA2D4_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-4 OS=Homo sapiens OX=9606 GN=CACNA2D4 PE=1 SV=2
14	O08532	1.76e-15	84.3	1103	0.123	0.142	CA2D1_MOUSE Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Mus musculus OX=10090 GN=Cacna2d1 PE=1 SV=1
15	A0A0B4K866	7.97e-15	82.4	1271	0.097	0.097	A0A0B4K866_DROME Straightjacket, isoform C OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
16	A0A0B4K7P4	4.23e-11	70.1	1237	0.057	0.058	A0A0B4K7P4_DROME Straightjacket, isoform D OS=Drosophila melanogaster OX=7227 GN=stj PE=1 SV=1
17	G3XD24	4.20e-08	60.1	629	0.030	0.060	PCTA_PSEAE Methyl-accepting chemotaxis protein PctA OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pctA PE=1 SV=1
18	P54576	8.63e-06	52.8	655	0.028	0.055	MCPC_BACSU Methyl-accepting chemotaxis protein McpC OS=Bacillus subtilis (strain 168) OX=224308 GN=mcpC PE=1 SV=2
19	G4S4A1	3.10e-05	50.8	1205	0.031	0.033	G4S4A1_CAEEL VWFA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-36 PE=1 SV=1
20	P34374	3.29e-05	50.8	1249	0.031	0.032	UNC36_CAEEL Voltage-dependent calcium channel unc-36 OS=Caenorhabditis elegans OX=6239 GN=unc-36 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02743 dCache_1	8.2e-07	40.3	Cache domain
2	PF20529 DUF6744	3.4e+02	11.5	Family of unknown function (DUF6744)
3	PF00092 VWA	0.065	25.0	von Willebrand factor type A domain
4	PF13768 VWA_3	5.5e+02	11.9	von Willebrand factor type A domain
5	PF08399 VWA_N	2.1e-23	94.6	VWA N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003806981.2

Rank	PPI partner	STRING score	Description
1	9597.XP_003809882.1	0.699	Calcium voltage-gated channel auxiliary subunit beta 1
2	9597.XP_003811485.1	0.674	Voltage-dependent L-type calcium channel subunit beta-2 isoform X1
3	9597.XP_003825857.1	0.674	Calcium voltage-gated channel auxiliary subunit beta 3
4	9597.XP_003832774.1	0.674	Voltage-dependent L-type calcium channel subunit beta-4 isoform X1
5	9597.XP_003812403.1	0.622	Voltage-dependent calcium channel gamma-1 subunit
6	9597.XP_003831274.1	0.593	Leucine rich repeat neuronal 1
7	9597.XP_003809407.1	0.591	Seizure 6-like protein 2 isoform X1
8	9597.XP_008973700.1	0.548	Catenin delta-2
9	9597.XP_003805845.1	0.539	General transcription factor IIH subunit 5
10	9597.XP_008963679.1	0.539	Leucine rich repeats and calponin homology domain containing 4
11	9597.XP_008971415.1	0.507	Protein sidekick-1
12	9597.XP_003823956.1	0.503	Belongs to the peptidase A1 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0099106	1.000	ion channel regulator activity
GO:0005245	1.000	voltage-gated calcium channel activity
GO:0005515	0.999	protein binding
GO:0005246	0.942	calcium channel regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.988	biological regulation
GO:0050789	0.979	regulation of biological process
GO:0009987	0.978	cellular process
GO:0006811	0.978	monoatomic ion transport
GO:0030001	0.909	metal ion transport
GO:0050794	0.903	regulation of cellular process
GO:0006816	0.903	calcium ion transport
GO:0032879	0.808	regulation of localization
GO:0051049	0.801	regulation of transport
GO:0010959	0.783	regulation of metal ion transport
GO:0050896	0.779	response to stimulus
GO:0098660	0.627	inorganic ion transmembrane transport
GO:0051924	0.627	regulation of calcium ion transport
GO:0034762	0.616	regulation of transmembrane transport
GO:0098662	0.548	inorganic cation transmembrane transport
GO:0034220	0.548	monoatomic ion transmembrane transport
GO:1904062	0.536	regulation of monoatomic cation transmembrane transport
GO:0098655	0.535	monoatomic cation transmembrane transport
GO:1903169	0.532	regulation of calcium ion transmembrane transport
GO:0070588	0.500	calcium ion transmembrane transport
GO:0051716	0.439	cellular response to stimulus
GO:0065009	0.341	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.990	protein-containing complex
GO:0005891	0.969	voltage-gated calcium channel complex
GO:0042383	0.903	sarcolemma
GO:0030315	0.715	T-tubule
GO:0043227	0.332	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]