StarFunc result for job id Q5VUA4

User Input

>input (2279 residues)
MYRSSARSSVSSHRPKDDGGGGPRSGRSSGSSSGPARRSSPPPPPSGSSSRTPARRPRSP
SGHRGRRASPSPPRGRRVSPSPPRARRGSPSPPRGRRLFPPGPAGFRGSSRGESRADYAR
DGRGDHPGDSGSRRRSPGLCSDSLEKSLRITVGNDHFCVSTPERRRLSDRLGSPVDNLED
MDRDDLTDDSVFTRSSQCSRGLERYISQEEGPLSPFLGQLDEDYRTKETFLHRSDYSPHI
SCHDELLRGTERNREKLKGYSIRSEERSREAKRPRYDDTVKINSMGGDHPSFTSGTRNYR
QRRRSPSPRFLDPEFRELDLARRKREEEEERSRSLSQELVGVDGGGTGCSIPGLSGVLTA
SEPGYSLHRPEEVSVMPKKSILKKRIEVDIMEPSMQLESFSSSTSSSQDHPLYSGHPSLP
LSGAIAAFASEIENKGTMVETALKEPQGNLYQWGPLPGIPKDNSPLREKFGSFLCHKDNL
DLKAEGPERHTDFLLPHERASQDGSGFSRILSMLADSTSTQEKRRRSFPDIEDEEKFLYG
DEEEDLKAESVPKPLGSSESEVMRQKASSLPSSAPAVKLESLEETNPEYAKIHDLLKTIG
LDIGVAEISQLAARTQERLHGKKPSLRSSADRRSSVDRYFSADHCSSVDHRFSADRCSSV
DHCFSADRRSSDPHRLESREAHHSNTHSPEVSHPHPPSPVDPYLLTKNSPPFLKSDHPVG
HISGPEVVGSGFQSSVAVRCMLPSAPSAPIRLPHTAALSQFHMPRASQFAAARIPPNYQG
PAIPPASFDAYRHYMAYAASRWPMYPTSQPSNHPVPEPHRIMPITKQATRSRPNLRVIPT
VTPDKPKQKESLRGSIPAAQVPVQVSIPSLIRYNPEKISDEKNRASQKQKVIEEREKLKN
DREARQKKMYYLRTELERLHKQQGEMLRKKRREKDGHKDPLLVEVSRLQDNIMKDIAELR
QEAEEAEKKQSELDKVAQILGINIFDKSQKSLSDSREPTEKPGKAEKSKSPEKVSSFSNS
SSNKESKVNNEKFRTKSPKPAESPQSATKQLDQPTAAYEYYDAGNHWCKDCNTICGTMFD
FFTHMHNKKHTQTLDPYNRPWASKTQSEAKQDAIKRTDKITVPAKGSEFLVPISGFYCQL
CEEFLGDPISGEQHVKGHQHNEKYKKYVDENPLYEERRNLDRQAGLAVVLETERRRQSEL
KRKLSEKPKEEKKEKKAKAVKEVKEDDKVSEKLEDQLSEGRNSPEKAENKRNTGIKLQLK
EEVKKESPTSSSFGKFSWKKPEKEEEKSSLVTPSISKEEILESSKDKEDGKTEAGKAKPI
KIKLSGKTVVAHTSPWMPVVTTSTQTKIRPNLPIPSTVLRKSCSATMSKPAPLNTFLSIK
SSGTTAKPLPVVKESSADLLLPPDIISKAFGGEEVILKGSPEEKVVLAEKSEPSHLPEQI
LPPPPPPPPPPPPPPPVIPHPAAPSAAQANAILAPVKSNPVVSQTLSPGFVGPNILNPVL
PVAIMASAQPAAIPSDETAPGVSESDRDQTLFSVLVRPPPPLSSVFSEQAKKLEKRNSCL
ATANAKDLYDIFYSSGGKGAPETKGAPETKLSGGPLANGENSNLSRTKSSDTSSTSPLNS
SASQEELHQDEGLVAAPIVSNSEKPIAKTLVALGKWSVVEHVGPKSTGSTYGFLQPLTRL
CQSRPYETITPKTDTLAIWTSSSFQSDTSRDISPEKSELDLGEPGPPGVEPPPQLLDIQC
KESQKLVEIHLRESVNQDKESQELRKSEDCRESEIETNTELKERVKELSEGIVDEGVSTS
IGPHSIDDSNLNHGNRYMWEGEVKQPNLLMIDKEAEQSNKLMTGSETPSKVVIKLSPQAC
SFTKAKLDSFLSEARSLLNPQDTPVKISAPELLLHSPARSAMCLTGSPQEQGVSVVSEEG
LENSAPESASRTSRYRSLKLKRERSKDFQVKKIYELAVWDENKKRPETWESPEKPKTEAL
ELQDVHPELTVTIESKALEDFEATDLKVEELTALGNLGDMPVDFCTTRVSPAHRSPTVLC
QKVCEENSVSPIGCNSSDPADFEPIPSFSGFPLDSPKTLVLDFETEGERNSPNPRSVRIP
SPNILKTGLTENVDRGLGGLEGTHQALDLLAGGMMPEEVKESSQLDKQESLGLELKTINS
AGLGPSPCLPDLVDFVTRTSGVQKDKLCSPLSEPGDPSKCSSLELGPLQLEISNASTTEV
AILQVDDDSGDPLNLVKAPVSRSPPREQVIEDNMVPQGMPEQETTVGAIQDHTESSVHN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VUA4	0.999	0.999	0.000	2279	1.000	1.000	Q5VUA4.pdb.gz	ZN318_HUMAN Zinc finger protein 318 OS=Homo sapiens OX=9606 GN=ZNF318 PE=1 SV=2
2	AFDB:Q99PP2	0.182	0.185	0.000	2237	0.719	0.732	Q99PP2.pdb.gz	ZN318_MOUSE Zinc finger protein 318 OS=Mus musculus OX=10090 GN=Znf318 PE=1 SV=3
3	AFDB:Q13023	0.030	0.029	1.044E-6	2319	0.119	0.117	Q13023.pdb.gz	AKAP6_HUMAN A-kinase anchor protein 6 OS=Homo sapiens OX=9606 GN=AKAP6 PE=1 SV=3
4	AFDB:Q9WVC7	0.036	0.036	5.512E-6	2314	0.121	0.119	Q9WVC7.pdb.gz	AKAP6_RAT A-kinase anchor protein 6 OS=Rattus norvegicus OX=10116 GN=Akap6 PE=1 SV=1
5	AFDB:P35658	0.027	0.029	1.266E-5	2090	0.106	0.115	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
6	AFDB:Q14966	0.032	0.036	3.160E-4	1978	0.136	0.156	Q14966.pdb.gz	ZN638_HUMAN Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638 PE=1 SV=2
7	AFDB:Q8C9B9	0.031	0.031	3.945E-4	2256	0.149	0.150	Q8C9B9.pdb.gz	DIDO1_MOUSE Death-inducer obliterator 1 OS=Mus musculus OX=10090 GN=Dido1 PE=1 SV=4
8	AFDB:Q80U93	0.026	0.027	5.816E-4	2085	0.117	0.128	Q80U93.pdb.gz	NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus OX=10090 GN=Nup214 PE=1 SV=2
9	AFDB:Q9VUQ9	0.030	0.031	6.498E-4	2139	0.131	0.140	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
10	AFDB:Q9BTC0	0.031	0.031	1.070E-3	2240	0.141	0.144	Q9BTC0.pdb.gz	DIDO1_HUMAN Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5
11	PDB:3k29A	0.041	0.303	3.059E-1	162	0.008	0.117	3k29A.pdb.gz
12	PDB:7myoB	0.042	0.220	4.511E-1	286	0.007	0.059	7myoB.pdb.gz	Cryo-EM structures of PI3K alpha reveal conformational changes during inhibition and activation.
13	PDB:6z6oC	0.037	0.114	4.768E-1	548	0.011	0.046	6z6oC.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
14	PDB:3lssA	0.032	0.148	5.952E-1	438	0.005	0.025	3lssA.pdb.gz	X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.
15	PDB:6tuyA	0.036	0.105	6.651E-1	667	0.009	0.030	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
16	PDB:7nsuD	0.044	0.219	6.651E-1	420	0.007	0.038	7nsuD.pdb.gz
17	PDB:5ew5A	0.039	0.141	9.277E-1	490	0.005	0.024	5ew5A.pdb.gz
18	PDB:6s1kE	0.036	0.496	1.294	102	0.004	0.098	6s1kE.pdb.gz
19	PDB:6yvvB	0.034	0.133	1.294	480	0.008	0.040	6yvvB.pdb.gz
20	PDB:8dcxB	0.045	0.359	1.294	236	0.006	0.059	8dcxB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5VUA4	0.0	4625	2279	1.000	1.000	ZN318_HUMAN Zinc finger protein 318 OS=Homo sapiens OX=9606 GN=ZNF318 PE=1 SV=2
2	Q99PP2	0.0	2891	2237	0.718	0.731	ZN318_MOUSE Zinc finger protein 318 OS=Mus musculus OX=10090 GN=Znf318 PE=1 SV=3
3	Q96KR1	0.058	41.2	1074	0.007	0.015	ZFR_HUMAN Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2
4	Q562A2	0.067	40.8	1073	0.007	0.015	ZFR_RAT Zinc finger RNA-binding protein OS=Rattus norvegicus OX=10116 GN=Zfr PE=1 SV=2
5	Q9H1R3	0.57	37.7	596	0.011	0.044	MYLK2_HUMAN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Homo sapiens OX=9606 GN=MYLK2 PE=1 SV=3
6	F4K209	0.92	37.4	995	0.013	0.030	F4K209_ARATH Endonuclease or glycosyl hydrolase with C2H2-type zinc finger domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=MAF19.19 PE=1 SV=1
7	A0A0S2Z4W1	1.7	36.2	904	0.013	0.032	A0A0S2Z4W1_HUMAN Serine/arginine repetitive matrix 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=SRRM1 PE=2 SV=1
8	Q8IYB3	1.7	36.2	904	0.013	0.032	SRRM1_HUMAN Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=2
9	A0A0S2Z4Z6	1.8	36.2	918	0.013	0.032	A0A0S2Z4Z6_HUMAN Serine and arginine repetitive matrix 1 (Fragment) OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=1
10	A9Z1X7	1.8	36.2	913	0.013	0.032	A9Z1X7_HUMAN Serine and arginine repetitive matrix 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=1
11	Q9DAC5	2.1	35.4	291	0.010	0.079	Q9DAC5_MOUSE RIKEN cDNA 1700013H16 gene OS=Mus musculus OX=10090 GN=1700013H16Rik PE=1 SV=1
12	M0R088	2.5	35.8	681	0.013	0.043	M0R088_HUMAN Serine and arginine repetitive matrix 1 (Fragment) OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=1
13	Q55GG3	2.8	35.4	818	0.015	0.043	Q55GG3_DICDI Ubiquitin-like domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0268498 PE=4 SV=2
14	F8W3Z0	3.9	35.4	2280	0.013	0.013	F8W3Z0_DANRE Calcium channel, voltage-dependent, P/Q type, alpha 1A subunit, b OS=Danio rerio OX=7955 GN=CACNA1Ab PE=2 SV=2
15	P08921	8.9	33.5	344	0.013	0.087	CD2_RAT T-cell surface antigen CD2 OS=Rattus norvegicus OX=10116 GN=Cd2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12171 zf-C2H2_jaz	8.5e+02	11.7	Zinc-finger double-stranded RNA-binding
2	PF06220 zf-U1	31	15.8	U1 zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354964

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000255087	0.574	Tesmin
2	9606.ENSP00000469647	0.561	mRNA decay activator protein ZFP36
3	9606.ENSP00000221972	0.529	B-cell antigen receptor complex-associated protein alpha chain
4	9606.ENSP00000363822	0.518	Androgen receptor
5	9606.ENSP00000329466	0.512	NAD-dependent protein deacetylase sirtuin-7
6	9606.ENSP00000388402	0.505	mRNA decay activator protein ZFP36L1
7	9606.ENSP00000325402	0.503	Myb-related transcription factor, partner of profilin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046982	1.000	protein heterodimerization activity
GO:0042803	1.000	protein homodimerization activity
GO:0097159	0.555	organic cyclic compound binding
GO:1901363	0.553	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.983	regulation of cellular process
GO:0010468	0.978	regulation of gene expression
GO:0048518	0.969	positive regulation of biological process
GO:0010558	0.969	negative regulation of macromolecule biosynthetic process
GO:0031327	0.969	negative regulation of cellular biosynthetic process
GO:0006355	0.966	regulation of DNA-templated transcription
GO:0051254	0.946	positive regulation of RNA metabolic process
GO:0045892	0.930	negative regulation of DNA-templated transcription
GO:0010557	0.700	positive regulation of macromolecule biosynthetic process
GO:0031328	0.696	positive regulation of cellular biosynthetic process
GO:0009987	0.663	cellular process
GO:0045893	0.575	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.996	nucleoplasm
GO:0032991	0.630	protein-containing complex
GO:0043232	0.511	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]