StarFunc result for job id Q5VUJ5

User Input

>input (663 residues)
MGNILTCRVHPSVSLEFDQQQGSVCPSESEIYEAGAEDRMAGAPMAAAVQPAEVTVEVGE
DLHMHHVRDREMPEALEFNPSANPEASTIFQRNSQTDVVEIRRSNCTNHVSTVHFSQQYS
LCSTIFLDDSTAIQHYLTMTIISVTLEIPHHITQRDADRSLSIPDEQLHSFAVSTVHITK
NRNGGGSLNNYSSSIPSTPSTSQEDPQFSVPPTANTPTPVCKRSMRWSNLFTSEKGSDPD
KERKAPENHADTIGSGRAIPIKQGMLLKRSGKWLKTWKKKYVTLCSNGVLTYYSSLGDYM
KYIHKKEIDLQTSTIKVPGKWPSLATLACTPISSSKSDGLSKDMDTGLGDSICFSPSISS
TTIPKLNPPPSPHANKKKHLKKKSTNNFMIVSATGQTWHFEATTYEERDAWVQAIQSQIL
ASLQSCESSKSKSQLTSQSEAMALQSIQNMRGNAHCVDCETQNPKWASLNLGVLMCIECS
GIHRSLGTRLSRVRSLELDDWPVELRKVMSSIGNDLANSIWEGSSQGRTKPTEKSTREEK
ERWIRSKYEEKLFLAPLPCTELSLGQQLLRATADEDLQTAILLLAHGSREEVNETCGEGD
GCTALHLACRKGNVVLAQLLIWYGVDVMARDAHGNTALTYARQASSQECINVLLQYGCPD
ECV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3lvqE	0.253	0.381	2.077E-14	420	0.113	0.179	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
2	PDB:3ljuX	0.176	0.307	3.313E-9	373	0.071	0.126	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
3	AFDB:Q54W22	0.123	0.111	1.506E-6	741	0.100	0.089	Q54W22.pdb.gz	Q54W22_DICDI PH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280015 PE=4 SV=1
4	PDB:3o47A	0.121	0.267	2.074E-5	289	0.048	0.111	3o47A.pdb.gz	Crystal structure of ARFGAP1-ARF1 fusion protein
5	AFDB:A2ABF8	0.142	0.088	2.491E-5	1233	0.149	0.080	A2ABF8.pdb.gz	A2ABF8_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
6	PDB:8cs9A	0.135	0.113	1.105E-4	796	0.044	0.036	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
7	PDB:6v9hC	0.131	0.315	1.612E-4	270	0.039	0.096	6v9hC.pdb.gz
8	PDB:6bbpA	0.126	0.160	3.250E-4	520	0.045	0.058	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
9	PDB:6hhgA	0.130	0.216	9.564E-4	386	0.042	0.073	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
10	PDB:6jd6B	0.130	0.439	1.065E-3	192	0.036	0.125	6jd6B.pdb.gz
11	PDB:4oauC	0.140	0.134	1.125E-3	692	0.044	0.042	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
12	PDB:2dvwA	0.124	0.349	1.253E-3	229	0.036	0.105	2dvwA.pdb.gz
13	AFDB:Q6W2J9	0.129	0.057	1.505E-3	1755	0.140	0.053	Q6W2J9.pdb.gz	BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1
14	AFDB:Q2IBD4	0.146	0.062	1.676E-3	1649	0.145	0.058	Q2IBD4.pdb.gz	CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Cttnbp2 PE=1 SV=1
15	AFDB:A2ABF9	0.159	0.090	1.769E-3	1267	0.133	0.069	A2ABF9.pdb.gz	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
16	AFDB:P34288	0.155	0.069	2.581E-3	1605	0.098	0.040	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
17	AFDB:Q8CGN4	0.132	0.054	2.581E-3	1759	0.131	0.049	Q8CGN4.pdb.gz	BCOR_MOUSE BCL-6 corepressor OS=Mus musculus OX=10090 GN=Bcor PE=1 SV=2
18	AFDB:Q8WZ74	0.145	0.060	2.724E-3	1663	0.149	0.060	Q8WZ74.pdb.gz	CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens OX=9606 GN=CTTNBP2 PE=1 SV=1
19	AFDB:Q5H9F3	0.124	0.051	4.195E-3	1711	0.152	0.059	Q5H9F3.pdb.gz	BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens OX=9606 GN=BCORL1 PE=1 SV=2
20	AFDB:A0A0G2K889	0.137	0.073	5.494E-3	1289	0.149	0.077	A0A0G2K889.pdb.gz	A0A0G2K889_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UPQ3	0.0	734	857	0.608	0.470	AGAP1_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AGAP1 PE=1 SV=4
2	U6A022	0.0	569	808	0.431	0.354	U6A022_RAT ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 OS=Rattus norvegicus OX=10116 GN=Agap3 PE=2 SV=1
3	J3KNM6	1.95e-147	456	1036	0.368	0.236	J3KNM6_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 (Fragment) OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
4	F8VVT9	5.31e-143	448	1192	0.371	0.206	F8VVT9_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
5	Q99490	8.61e-143	448	1192	0.371	0.206	AGAP2_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=2
6	Q8CGU4	4.48e-137	432	1186	0.379	0.212	AGAP2_RAT Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Agap2 PE=1 SV=1
7	Q3UHD9	6.08e-137	432	1186	0.379	0.212	AGAP2_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Agap2 PE=1 SV=1
8	Q8VHH5	1.89e-134	419	910	0.296	0.215	AGAP3_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Agap3 PE=1 SV=1
9	A0JMI1	2.96e-131	408	827	0.370	0.296	A0JMI1_DANRE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Danio rerio OX=7955 GN=agap2 PE=2 SV=1
10	Q9XX14	9.78e-82	282	1107	0.281	0.168	CNT2_CAEEL Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 OS=Caenorhabditis elegans OX=6239 GN=cnt-2 PE=1 SV=2
11	Q9NGC3	3.98e-76	265	995	0.213	0.142	CEG1A_DROME Centaurin-gamma-1A OS=Drosophila melanogaster OX=7227 GN=CenG1A PE=2 SV=2
12	Q54WI0	1.88e-38	155	1333	0.176	0.088	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1
13	Q4QQN0	2.94e-35	143	626	0.124	0.131	Q4QQN0_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
14	Q3UH98	4.45e-35	144	833	0.124	0.098	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
15	Q6NXL5	4.61e-35	144	833	0.124	0.098	Q6NXL5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
16	A2ADA6	5.27e-35	144	829	0.124	0.099	A2ADA6_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
17	Q8N7R7	3.56e-33	133	359	0.130	0.240	CCYL1_HUMAN Cyclin-Y-like protein 1 OS=Homo sapiens OX=9606 GN=CCNYL1 PE=1 SV=2
18	Q8MSZ5	1.99e-32	127	235	0.103	0.289	Q8MSZ5_DROME GM06875p OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=2 SV=1
19	Q15057	1.33e-31	133	778	0.115	0.098	ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3
20	Q5FVC7	2.89e-31	132	770	0.115	0.099	ACAP2_RAT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Acap2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	3.5e-06	38.4	Ankyrin repeat
2	PF12796 Ank_2	1.8e-06	39.7	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1	21.0	Ankyrin repeat
4	PF13637 Ank_4	0.0083	28.0	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.5e-05	36.4	Ankyrin repeats (many copies)
6	PF01412 ArfGap	3.9e-34	128.6	Putative GTPase activating protein for Arf
7	PF00169 PH	2.6e-07	42.4	PH domain
8	PF15413 PH_11	0.12	24.3	Pleckstrin homology domain
9	PF15404 PH_4	1.3e+02	13.8	Pleckstrin homology domain
10	PF15406 PH_6	8.2	18.1	Pleckstrin homology domain
11	PF15409 PH_8	6.4	18.5	Pleckstrin homology domain
12	PF15410 PH_9	7.7e+02	11.7	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000392513

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387176	0.576	POTE ankyrin domain family member J
2	9606.ENSP00000392718	0.567	POTE ankyrin domain family member I
3	9606.ENSP00000237822	0.564	Lipid droplet-associated hydrolase
4	9606.ENSP00000338013	0.515	Coiled-coil domain containing 183

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005543	0.975	phospholipid binding
GO:0003824	0.894	catalytic activity
GO:0098772	0.793	molecular function regulator activity
GO:0016787	0.600	hydrolase activity
GO:0030234	0.570	enzyme regulator activity
GO:0030695	0.433	GTPase regulator activity
GO:0043167	0.363	ion binding
GO:0043168	0.345	anion binding
GO:0005096	0.340	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.966	anatomical structure development
GO:0009987	0.669	cellular process
GO:0065007	0.642	biological regulation
GO:0032501	0.632	multicellular organismal process
GO:0050789	0.438	regulation of biological process
GO:0007275	0.306	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0005737	0.998	cytoplasm
GO:0043227	0.978	membrane-bounded organelle
GO:0043231	0.970	intracellular membrane-bounded organelle
GO:0071944	0.944	cell periphery
GO:0016020	0.896	membrane
GO:0005634	0.719	nucleus
GO:0005886	0.399	plasma membrane
GO:0012505	0.390	endomembrane system
GO:0005829	0.306	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.600	Hydrolases.

[back to server]