StarFunc result for job id Q5VUJ6

User Input

>input (765 residues)
MAASQGGGGNSGGGGCGGGGSSGGCGTAGGGGGGAGGGGGGGGGTLVVPIPVPTLFGQPF
PNGPPWNPGSLQPQHTVRSLDRALEEAGSSGILSLSGRKLRDFPGSGYDLTDTTQADLSR
NRFTEIPSDVWLFAPLETLNLYHNCIKTIPEAIKNLQMLTYLNISRNLLSTLPKYLFDLP
LKVLVVSNNKLVSIPEEIGKLKDLMELDISCNEIQVLPQQMGKLHSLRELNIRRNNLHVL
PDELGDLPLVKLDFSCNKVTEIPVCYRKLHHLQVIILDNNPLQVPPAQICLKGKVHIFKY
LNIQACCRMDKKPDSLDLPSLSKRMPSQPLTDSMEDFYPNKNHGPDSGIGSDNGEKRLST
TEPSDDDTVSLHSQVSESNREQTSRNDSHIIGSKTDSQKDQEVYDFVDPNTEDVAVPEQG
NAHIGSFVSFFKGKEKCSEKSRKNEELGDEKRLEKEQLLAEEEDDDLKEVTDLRKIAAQL
LQQEQKNRILNHSTSVMRNKPKQTVECEKSVSADEVNSPLSPLTWQPLENQKDQIDEQPW
PESHPIIWQSEERRRSKQIRKEYFKYKSMRKSSSGNENDEQDSDNANMSTQSPVSSEEYD
RTDGFSHSPFGLKPRSAFSRSSRQEYGAADPGFTMRRKMEHLREEREQIRQLRNNLESRL
KVILPDDIGAALMDGVVLCHLANHIRPRSVASIHVPSPAVPKLSMAKCRRNVENFLDACK
KLGVSQERLCLPHHILEERGLVKVGVTVQALLELPTTKASQLSVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VUJ6	1.000	1.000	1.534E-101	765	1.000	1.000	Q5VUJ6.pdb.gz	LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LRCH2 PE=1 SV=2
2	AFDB:Q921G6	0.315	0.353	9.553E-42	680	0.342	0.385	Q921G6.pdb.gz	LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus OX=10090 GN=Lrch4 PE=1 SV=1
3	AFDB:Q9VJE6	0.304	0.206	2.264E-38	1135	0.325	0.219	Q9VJE6.pdb.gz	Q9VJE6_DROME Leucine-rich-repeats and calponin homology domain protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Lrch PE=1 SV=1
4	AFDB:H7C1G3	0.170	0.583	8.440E-14	214	0.142	0.509	H7C1G3.pdb.gz	H7C1G3_HUMAN Leucine rich repeats and calponin homology domain containing 3 (Fragment) OS=Homo sapiens OX=9606 GN=LRCH3 PE=1 SV=1
5	PDB:7lt9A	0.281	0.824	2.422E-12	251	0.099	0.303	7lt9A.pdb.gz	Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly.
6	AFDB:M0R9T2	0.219	0.135	2.924E-12	1258	0.125	0.076	M0R9T2.pdb.gz	M0R9T2_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=3
7	AFDB:P70587	0.228	0.119	7.009E-12	1490	0.136	0.070	P70587.pdb.gz	LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Lrrc7 PE=1 SV=2
8	AFDB:Q96RT1	0.220	0.120	7.724E-12	1412	0.137	0.074	Q96RT1.pdb.gz	ERBIN_HUMAN Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2
9	PDB:7tvfD	0.263	0.387	1.774E-11	515	0.088	0.130	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
10	AFDB:Q86P15	0.160	0.153	1.329E-9	817	0.128	0.120	Q86P15.pdb.gz	Q86P15_DROME RE09158p OS=Drosophila melanogaster OX=7227 GN=ltl PE=2 SV=1
11	PDB:7p5vB	0.260	0.271	2.129E-8	732	0.073	0.077	7p5vB.pdb.gz
12	AFDB:Q9LJ64	0.196	0.160	3.792E-8	956	0.133	0.107	Q9LJ64.pdb.gz	PLRX1_ARATH Pollen-specific leucine-rich repeat extensin-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=PEX1 PE=1 SV=1
13	PDB:6hkwA	0.233	0.567	4.003E-8	306	0.064	0.160	6hkwA.pdb.gz
14	PDB:7ploO	0.187	0.367	4.119E-7	382	0.065	0.131	7ploO.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
15	PDB:1xcdA	0.217	0.519	5.786E-7	305	0.064	0.161	1xcdA.pdb.gz
16	PDB:5xjxC	0.218	0.438	7.744E-7	365	0.068	0.142	5xjxC.pdb.gz
17	PDB:5yq5B	0.222	0.534	7.744E-7	306	0.064	0.160	5yq5B.pdb.gz
18	AFDB:Q9NT99	0.239	0.253	1.938E-6	713	0.140	0.150	Q9NT99.pdb.gz	LRC4B_HUMAN Leucine-rich repeat-containing protein 4B OS=Homo sapiens OX=9606 GN=LRRC4B PE=2 SV=3
19	PDB:7ax1A	0.142	0.203	2.147E-6	518	0.063	0.093	7ax1A.pdb.gz	Crystal structure and functional properties of the human CCR4-CAF1 deadenylase complex.
20	PDB:6m04A	0.235	0.252	8.365E-6	714	0.081	0.087	6m04A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5VUJ6	0.0	1573	765	1.000	1.000	LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LRCH2 PE=1 SV=2
2	Q9Y2L9	0.0	537	728	0.431	0.453	LRCH1_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LRCH1 PE=1 SV=3
3	P62046	2.21e-119	377	709	0.258	0.278	LRCH1_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Mus musculus OX=10090 GN=Lrch1 PE=1 SV=2
4	Q96II8	1.27e-117	374	777	0.275	0.270	LRCH3_HUMAN DISP complex protein LRCH3 OS=Homo sapiens OX=9606 GN=LRCH3 PE=1 SV=2
5	Q921G6	4.89e-96	315	680	0.244	0.275	LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus OX=10090 GN=Lrch4 PE=1 SV=1
6	O75427	4.29e-93	307	683	0.239	0.268	LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens OX=9606 GN=LRCH4 PE=1 SV=2
7	Q960C5	5.65e-61	222	809	0.159	0.151	LRCH_DROME Leucine-rich repeat and calponin homology domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Lrch PE=2 SV=1
8	X2JA56	5.77e-60	222	1079	0.159	0.113	X2JA56_DROME Leucine-rich-repeats and calponin homology domain protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Lrch PE=1 SV=1
9	Q9VJE6	6.33e-60	222	1135	0.159	0.107	Q9VJE6_DROME Leucine-rich-repeats and calponin homology domain protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Lrch PE=1 SV=1
10	H7C1G3	3.53e-52	182	214	0.116	0.416	H7C1G3_HUMAN Leucine rich repeats and calponin homology domain containing 3 (Fragment) OS=Homo sapiens OX=9606 GN=LRCH3 PE=1 SV=1
11	E9PD99	4.14e-48	182	623	0.119	0.146	E9PD99_HUMAN Leucine rich repeats and calponin homology domain containing 3 OS=Homo sapiens OX=9606 GN=LRCH3 PE=1 SV=1
12	H7C0J8	1.13e-39	148	227	0.092	0.308	H7C0J8_HUMAN Leucine rich repeats and calponin homology domain containing 3 (Fragment) OS=Homo sapiens OX=9606 GN=LRCH3 PE=1 SV=1
13	B0M0P8	2.22e-24	112	2356	0.097	0.031	GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum OX=44689 GN=gefL PE=2 SV=1
14	Q8S7M7	6.71e-24	108	543	0.090	0.127	PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica OX=39947 GN=IRL5 PE=2 SV=1
15	Q6Z8P4	1.33e-22	105	576	0.089	0.118	PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica OX=39947 GN=IRL4 PE=2 SV=1
16	Q01730	4.92e-21	96.3	277	0.090	0.249	RSU1_MOUSE Ras suppressor protein 1 OS=Mus musculus OX=10090 GN=Rsu1 PE=1 SV=3
17	Q9FFJ3	7.31e-21	99.4	506	0.094	0.142	PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana OX=3702 GN=PIRL1 PE=2 SV=1
18	Q4H4B6	7.88e-21	100	1724	0.107	0.048	SCRIB_DANRE Protein scribble homolog OS=Danio rerio OX=7955 GN=scrib PE=1 SV=1
19	Q15404	1.03e-20	95.1	277	0.092	0.253	RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens OX=9606 GN=RSU1 PE=1 SV=3
20	Q8VYG9	4.36e-20	96.7	499	0.090	0.138	PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 9 OS=Arabidopsis thaliana OX=3702 GN=PIRL9 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11971 CAMSAP_CH	60	14.9	CAMSAP CH domain
2	PF06395 CDC24	35	16.1	CDC24 Calponin
3	PF00307 CH	7.6e-06	37.4	Calponin homology (CH) domain
4	PF19148 DUF5830	92	14.4	Family of unknown function (DUF5830)
5	PF00560 LRR_1	1.2	20.7	Leucine Rich Repeat
6	PF12799 LRR_4	1.3e-10	52.5	Leucine Rich repeats (2 copies)
7	PF13855 LRR_8	2.6e-22	89.6	Leucine rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325091

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000394888	0.706	Dedicator of cytokinesis protein 8
2	9606.ENSP00000334375	0.681	Leucine rich repeats and calponin homology domain containing 3
3	9606.ENSP00000217958	0.650	26S proteasome non-ATPase regulatory subunit 10
4	9606.ENSP00000328998	0.642	Trafficking kinesin-binding protein 1
5	9606.ENSP00000228825	0.622	Actin-related protein 2/3 complex subunit 3
6	9606.ENSP00000320924	0.550	WAS/WASL-interacting protein family member 2
7	9606.ENSP00000378254	0.543	Echinoderm microtubule-associated protein-like 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0050896	0.889	response to stimulus
GO:0065009	0.783	regulation of molecular function
GO:0050790	0.763	regulation of catalytic activity
GO:0048523	0.755	negative regulation of cellular process
GO:0044092	0.752	negative regulation of molecular function
GO:0042221	0.533	response to chemical
GO:0043086	0.442	negative regulation of catalytic activity
GO:0010033	0.431	response to organic substance
GO:0051346	0.419	negative regulation of hydrolase activity
GO:0071840	0.332	cellular component organization or biogenesis
GO:0051716	0.328	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.988	cytosol
GO:0043226	0.743	organelle
GO:0043229	0.720	intracellular organelle
GO:0043231	0.710	intracellular membrane-bounded organelle
GO:0016020	0.379	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]