StarFunc result for job id Q5VV16

User Input

>input (416 residues)
MNLPRAERPRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEARQQFLEQSLQPGLQ
VARWGGVALPREHIEGGGGPSDPSEFGTKFRAPPRSAAASEDARQPAKPPYSYIALITMA
ILQNPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGN
YWSLDPASQDMFDNGSFLRRRKRFKRHQLTPGAHLPHPFPLPAAHAALHNPHPGPLLGAP
APPQPVPGAYPNTAPGRCPYALLHPHPLRYLLLSAPVYAGAPKKAEGADLATPAPFPCCS
PHLVLSLGRRARVWRRHREADASLSALRVLCKGSGERVQGLRRVCPRPRGATATCSSDHQ
ACCIPKPLPLCCKCPPPLLLGQFCSNSSSIRRTAPTAALPPRARCWAGTCRPRRRC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3SYB3	0.395	0.394	2.340E-61	417	0.981	0.978	Q3SYB3.pdb.gz	FX4L6_HUMAN Forkhead box protein D4-like 6 OS=Homo sapiens OX=9606 GN=FOXD4L6 PE=1 SV=2
2	AFDB:Q12950	0.328	0.312	7.093E-51	439	0.844	0.800	Q12950.pdb.gz	FOXD4_HUMAN Forkhead box protein D4 OS=Homo sapiens OX=9606 GN=FOXD4 PE=1 SV=4
3	AFDB:Q9NU39	0.324	0.331	5.004E-46	408	0.716	0.730	Q9NU39.pdb.gz	FX4L1_HUMAN Forkhead box protein D4-like 1 OS=Homo sapiens OX=9606 GN=FOXD4L1 PE=1 SV=1
4	AFDB:Q16676	0.267	0.239	1.061E-21	465	0.394	0.353	Q16676.pdb.gz	FOXD1_HUMAN Forkhead box protein D1 OS=Homo sapiens OX=9606 GN=FOXD1 PE=1 SV=1
5	AFDB:Q61574	0.279	0.348	2.843E-17	329	0.262	0.331	Q61574.pdb.gz	FOXS1_MOUSE Forkhead box protein S1 OS=Mus musculus OX=10090 GN=Foxs1 PE=2 SV=2
6	AFDB:Q18694	0.243	0.303	3.681E-17	333	0.274	0.342	Q18694.pdb.gz	UN130_CAEEL Forkhead box protein unc-130 OS=Caenorhabditis elegans OX=6239 GN=unc-130 PE=1 SV=1
7	AFDB:E7FER3	0.277	0.270	4.467E-17	429	0.231	0.224	E7FER3.pdb.gz	E7FER3_DANRE Forkhead box F2b OS=Danio rerio OX=7955 GN=foxf2b PE=4 SV=1
8	AFDB:O54743	0.261	0.245	4.467E-17	446	0.274	0.256	O54743.pdb.gz	FOXF2_MOUSE Forkhead box protein F2 OS=Mus musculus OX=10090 GN=Foxf2 PE=2 SV=2
9	AFDB:P34683	0.262	0.453	8.693E-16	237	0.197	0.346	P34683.pdb.gz	LIN31_CAEEL Protein lin-31 OS=Caenorhabditis elegans OX=6239 GN=lin-31 PE=4 SV=1
10	AFDB:O73779	0.244	0.342	1.280E-15	297	0.216	0.303	O73779.pdb.gz	O73779_DANRE Fork head domain protein FKD3 OS=Danio rerio OX=7955 GN=foxb1.2 PE=2 SV=1
11	PDB:2hdcA	0.197	0.682	7.197E-12	97	0.207	0.887	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:5k1yD	0.128	0.465	4.636E-2	92	0.041	0.185	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
13	PDB:4a6dA	0.133	0.158	6.829E-2	345	0.024	0.029	4a6dA.pdb.gz	Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
14	PDB:7k5yU	0.151	0.669	1.144E-1	75	0.031	0.173	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
15	PDB:3cuqA	0.119	0.205	1.221E-1	219	0.034	0.064	3cuqA.pdb.gz
16	PDB:2nyxB	0.141	0.353	1.685E-1	147	0.022	0.061	2nyxB.pdb.gz
17	PDB:6iwtA	0.138	0.162	1.918E-1	346	0.031	0.038	6iwtA.pdb.gz
18	PDB:5h3rA	0.123	0.323	2.824E-1	141	0.026	0.078	5h3rA.pdb.gz	Structural characterization of the DNA-binding mechanism underlying the copper(II)-sensing MarR transcriptional regulator.
19	PDB:2qbyB	0.147	0.164	3.013E-1	368	0.019	0.022	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
20	PDB:7a6hO	0.132	0.110	3.213E-1	512	0.026	0.021	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q12950	0.0	629	439	0.815	0.772	FOXD4_HUMAN Forkhead box protein D4 OS=Homo sapiens OX=9606 GN=FOXD4 PE=1 SV=4
2	Q3SYB3	0.0	810	417	0.981	0.978	FX4L6_HUMAN Forkhead box protein D4-like 6 OS=Homo sapiens OX=9606 GN=FOXD4L6 PE=1 SV=2
3	Q6VB84	0.0	808	417	0.976	0.974	FX4L3_HUMAN Forkhead box protein D4-like 3 OS=Homo sapiens OX=9606 GN=FOXD4L3 PE=1 SV=2
4	Q8WXT5	0.0	830	416	0.995	0.995	FX4L4_HUMAN Forkhead box protein D4-like 4 OS=Homo sapiens OX=9606 GN=FOXD4L4 PE=1 SV=2
5	Q9NU39	0.0	514	408	0.685	0.699	FX4L1_HUMAN Forkhead box protein D4-like 1 OS=Homo sapiens OX=9606 GN=FOXD4L1 PE=1 SV=1
6	Q9DEN4	7.46e-57	193	371	0.245	0.275	FXD3A_XENLA Forkhead box protein D3-A OS=Xenopus laevis OX=8355 GN=foxd3-a PE=1 SV=1
7	Q9DEN3	2.67e-55	189	371	0.233	0.261	FXD3B_XENLA Forkhead box protein D3-B OS=Xenopus laevis OX=8355 GN=foxd3-b PE=2 SV=1
8	Q18694	2.07e-54	185	333	0.238	0.297	UN130_CAEEL Forkhead box protein unc-130 OS=Caenorhabditis elegans OX=6239 GN=unc-130 PE=1 SV=1
9	F1R5S7	9.11e-54	185	371	0.260	0.291	F1R5S7_DANRE Forkhead box protein D3 OS=Danio rerio OX=7955 GN=fkd-6 PE=1 SV=1
10	O73784	1.39e-52	180	321	0.221	0.287	O73784_DANRE Fork head domain protein FKD8 OS=Danio rerio OX=7955 GN=fkd8 PE=2 SV=1
11	Q9PRJ8	1.47e-52	181	352	0.221	0.261	FXD5A_XENLA Forkhead box protein D5-A OS=Xenopus laevis OX=8355 GN=foxd5-a PE=2 SV=1
12	Q9PT68	2.31e-52	181	353	0.276	0.326	FXD5B_XENLA Forkhead box protein D5-B OS=Xenopus laevis OX=8355 GN=foxd5-b PE=2 SV=1
13	P79772	3.43e-52	181	394	0.219	0.231	FOXD3_CHICK Forkhead box protein D3 OS=Gallus gallus OX=9031 GN=FOXD3 PE=2 SV=1
14	Q61060	7.19e-52	182	465	0.219	0.196	FOXD3_MOUSE Forkhead box protein D3 OS=Mus musculus OX=10090 GN=Foxd3 PE=2 SV=3
15	Q9UJU5	2.49e-51	181	478	0.219	0.190	FOXD3_HUMAN Forkhead box protein D3 OS=Homo sapiens OX=9606 GN=FOXD3 PE=1 SV=1
16	Q63245	3.96e-51	169	101	0.190	0.782	FOXD3_RAT Forkhead box protein D3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Foxd3 PE=1 SV=1
17	Q16676	4.26e-50	177	465	0.192	0.172	FOXD1_HUMAN Forkhead box protein D1 OS=Homo sapiens OX=9606 GN=FOXD1 PE=1 SV=1
18	Q9PSY4	1.20e-49	173	345	0.188	0.226	FOXD1_XENLA Forkhead box protein D1 OS=Xenopus laevis OX=8355 GN=foxd1 PE=2 SV=2
19	Q61345	1.59e-49	176	456	0.190	0.173	FOXD1_MOUSE Forkhead box protein D1 OS=Mus musculus OX=10090 GN=Foxd1 PE=2 SV=2
20	O60548	1.71e-49	176	495	0.192	0.162	FOXD2_HUMAN Forkhead box protein D2 OS=Homo sapiens OX=9606 GN=FOXD2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	2.1e-32	122.4	Forkhead domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366637

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366826	0.692	Ankyrin repeat domain-containing protein 20A2
2	9606.ENSP00000395629	0.618	Zinc finger protein 812
3	9606.ENSP00000477392	0.537	Zinc finger protein 595

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.954	DNA binding
GO:0140110	0.920	transcription regulator activity
GO:0003700	0.865	DNA-binding transcription factor activity
GO:0043565	0.834	sequence-specific DNA binding
GO:0003690	0.686	double-stranded DNA binding
GO:1990837	0.661	sequence-specific double-stranded DNA binding
GO:0000976	0.599	transcription cis-regulatory region binding
GO:0000981	0.373	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.988	anatomical structure development
GO:0050794	0.985	regulation of cellular process
GO:0010468	0.979	regulation of gene expression
GO:0006355	0.916	regulation of DNA-templated transcription
GO:0032501	0.904	multicellular organismal process
GO:0007275	0.811	multicellular organism development
GO:0006357	0.789	regulation of transcription by RNA polymerase II
GO:0048731	0.725	system development
GO:0009987	0.491	cellular process
GO:0048519	0.477	negative regulation of biological process
GO:0048523	0.440	negative regulation of cellular process
GO:0010605	0.396	negative regulation of macromolecule metabolic process
GO:0048518	0.330	positive regulation of biological process
GO:0007399	0.325	nervous system development
GO:0031324	0.322	negative regulation of cellular metabolic process
GO:0051172	0.312	negative regulation of nitrogen compound metabolic process
GO:0048513	0.305	animal organ development
GO:0048522	0.300	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.925	intracellular organelle lumen
GO:0031981	0.868	nuclear lumen
GO:0005654	0.720	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]