StarFunc result for job id Q5VV43

User Input

>input (1072 residues)
MAPPTGVLSSLLLLVTIAGCARKQCSEGRTYSNAVISPNLETTRIMRVSHTFPVVDCTAA
CCDLSSCDLAWWFEGRCYLVSCPHKENCEPKKMGPIRSYLTFVLRPVQRPAQLLDYGDMM
LNRGSPSGIWGDSPEDIRKDLTFLGKDWGLEEMSEYSDDYRELEKDLLQPSGKQEPRGSA
EYTDWGLLPGSEGAFNSSVGDSPAVPAETQQDPELHYLNESASTPAPKLPERSVLLPLPT
TPSSGEVLEKEKASQLQEQSSNSSGKEVLMPSHSLPPASLELSSVTVEKSPVLTVTPGST
EHSIPTPPTSAAPSESTPSELPISPTTAPRTVKELTVSAGDNLIITLPDNEVELKAFVAP
APPVETTYNYEWNLISHPTDYQGEIKQGHKQTLNLSQLSVGLYVFKVTVSSENAFGEGFV
NVTVKPARRVNLPPVAVVSPQLQELTLPLTSALIDGSQSTDDTEIVSYHWEEINGPFIEE
KTSVDSPVLRLSNLDPGNYSFRLTVTDSDGATNSTTAALIVNNAVDYPPVANAGPNHTIT
LPQNSITLNGNQSSDDHQIVLYEWSLGPGSEGKHVVMQGVQTPYLHLSAMQEGDYTFQLK
VTDSSRQQSTAVVTVIVQPENNRPPVAVAGPDKELIFPVESATLDGSSSSDDHGIVFYHW
EHVRGPSAVEMENIDKAIATVTGLQVGTYHFRLTVKDQQGLSSTSTLTVAVKKENNSPPR
ARAGGRHVLVLPNNSITLDGSRSTDDQRIVSYLWIRDGQSPAAGDVIDGSDHSVALQLTN
LVEGVYTFHLRVTDSQGASDTDTATVEVQPDPRKSGLVELTLQVGVGQLTEQRKDTLVRQ
LAVLLNVLDSDIKVQKIRAHSDLSTVIVFYVQSRPPFKVLKAAEVARNLHMRLSKEKADF
LLFKVLRVDTAGCLLKCSGHGHCDPLTKRCICSHLWMENLIQRYIWDGESNCEWSIFYVT
VLAFTLIVLTGGFTWLCICCCKRQKRTKIRKKTKYTILDNMDEQERMELRPKYGIKHRST
EHNSSLMVSESEFDSDQDTIFSREKMERGNPKVSMNGSIRNGASFSYCSKDR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5SZV5	0.384	0.381	0.000	1081	0.767	0.760	Q5SZV5.pdb.gz	K0319_MOUSE Dyslexia-associated protein KIAA0319 homolog OS=Mus musculus OX=10090 GN=Kiaa0319 PE=1 SV=1
2	AFDB:Q5VV43	1.000	1.000	0.000	1072	1.000	1.000	Q5VV43.pdb.gz	K0319_HUMAN Dyslexia-associated protein KIAA0319 OS=Homo sapiens OX=9606 GN=KIAA0319 PE=1 SV=1
3	AFDB:Q9VAF5	0.182	0.131	2.560E-22	1706	0.118	0.074	Q9VAF5.pdb.gz	CAD99_DROME Cadherin-99C OS=Drosophila melanogaster OX=7227 GN=Cad99C PE=1 SV=2
4	AFDB:Q96QU1	0.109	0.067	1.573E-20	1955	0.115	0.063	Q96QU1.pdb.gz	PCD15_HUMAN Protocadherin-15 OS=Homo sapiens OX=9606 GN=PCDH15 PE=1 SV=2
5	PDB:4aq1A	0.114	0.156	5.341E-16	721	0.063	0.094	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
6	AFDB:G5EBF1	0.106	0.094	8.480E-16	1273	0.108	0.091	G5EBF1.pdb.gz	SAX3_CAEEL Protein sax-3 OS=Caenorhabditis elegans OX=6239 GN=sax-3 PE=2 SV=1
7	AFDB:Q9Y5H8	0.131	0.144	3.811E-14	950	0.104	0.117	Q9Y5H8.pdb.gz	PCDA3_HUMAN Protocadherin alpha-3 OS=Homo sapiens OX=9606 GN=PCDHA3 PE=2 SV=1
8	AFDB:B7YZW3	0.113	0.073	4.015E-14	2064	0.128	0.066	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
9	AFDB:Q91Y18	0.126	0.138	4.015E-14	950	0.102	0.115	Q91Y18.pdb.gz	Q91Y18_MOUSE Protocadherin alpha 12 OS=Mus musculus OX=10090 GN=Pcdha12 PE=1 SV=1
10	PDB:7sqcO0	0.073	0.069	1.413E-13	1140	0.054	0.051	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
11	AFDB:P13595	0.097	0.095	1.821E-13	1115	0.085	0.082	P13595.pdb.gz	NCAM1_MOUSE Neural cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ncam1 PE=1 SV=3
12	AFDB:Q91Y11	0.134	0.143	3.586E-13	979	0.106	0.116	Q91Y11.pdb.gz	PCDA9_MOUSE Protocadherin alpha-9 OS=Mus musculus OX=10090 GN=Pcdha9 PE=2 SV=1
13	PDB:5oj2B	0.089	0.124	2.618E-12	692	0.075	0.116	5oj2B.pdb.gz
14	PDB:1e07A	0.095	0.138	3.770E-12	642	0.054	0.090	1e07A.pdb.gz
15	PDB:7q5zA	0.089	0.076	2.317E-10	1344	0.067	0.054	7q5zA.pdb.gz
16	PDB:7q1yA	0.084	0.071	5.921E-10	1374	0.064	0.050	7q1yA.pdb.gz
17	PDB:4rtdA	0.071	0.069	8.985E-10	1122	0.064	0.061	4rtdA.pdb.gz
18	PDB:5a42A	0.085	0.065	1.513E-9	1597	0.076	0.051	5a42A.pdb.gz
19	PDB:6dldD	0.086	0.272	9.382E-9	269	0.040	0.160	6dldD.pdb.gz
20	PDB:6h03A	0.095	0.087	1.283E-8	1223	0.073	0.064	6h03A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087X0U9	0.0	1009	483	0.451	1.000	A0A087X0U9_HUMAN KIAA0319 OS=Homo sapiens OX=9606 GN=KIAA0319 PE=1 SV=1
2	E7EN73	0.0	901	1026	0.478	0.499	E7EN73_HUMAN Dyslexia-associated protein KIAA0319-like protein (Fragment) OS=Homo sapiens OX=9606 GN=KIAA0319L PE=1 SV=1
3	Q5SZV5	0.0	1590	1081	0.766	0.759	K0319_MOUSE Dyslexia-associated protein KIAA0319 homolog OS=Mus musculus OX=10090 GN=Kiaa0319 PE=1 SV=1
4	Q5VV43	0.0	2215	1072	1.000	1.000	K0319_HUMAN Dyslexia-associated protein KIAA0319 OS=Homo sapiens OX=9606 GN=KIAA0319 PE=1 SV=1
5	Q8IZA0	0.0	908	1049	0.482	0.493	K319L_HUMAN Dyslexia-associated protein KIAA0319-like protein OS=Homo sapiens OX=9606 GN=KIAA0319L PE=1 SV=2
6	Q8K135	0.0	926	1048	0.485	0.496	K319L_MOUSE Dyslexia-associated protein KIAA0319-like protein OS=Mus musculus OX=10090 GN=Kiaa0319l PE=1 SV=1
7	Q8CB67	3.76e-15	82.0	483	0.042	0.093	LRP11_MOUSE Low-density lipoprotein receptor-related protein 11 OS=Mus musculus OX=10090 GN=Lrp11 PE=1 SV=1
8	Q86VZ4	2.42e-14	79.3	500	0.048	0.102	LRP11_HUMAN Low-density lipoprotein receptor-related protein 11 OS=Homo sapiens OX=9606 GN=LRP11 PE=2 SV=2
9	A0A2R8QCE4	9.91e-12	71.2	523	0.050	0.103	A0A2R8QCE4_DANRE Serine peptidase inhibitor, Kunitz type 1 a OS=Danio rerio OX=7955 GN=cb376 PE=1 SV=1
10	Q7T363	5.06e-11	68.9	516	0.037	0.078	Q7T363_DANRE Serine peptidase inhibitor, Kunitz type 1 a precursor OS=Danio rerio OX=7955 GN=zgc:64075 PE=1 SV=1
11	A9JR82	7.23e-11	68.2	499	0.035	0.076	A9JR82_DANRE Serine peptidase inhibitor, Kunitz type 1 b precursor OS=Danio rerio OX=7955 GN=spint1b PE=1 SV=1
12	Q46085	1.49e-04	48.5	1021	0.048	0.050	COLH_HATHI Collagenase ColH OS=Hathewaya histolytica OX=1498 GN=colH PE=1 SV=1
13	Q9X721	0.023	41.2	1118	0.063	0.061	COLG_HATHI Collagenase ColG OS=Hathewaya histolytica OX=1498 GN=colG PE=1 SV=1
14	P98161	0.087	39.7	4303	0.090	0.023	PKD1_HUMAN Polycystin-1 OS=Homo sapiens OX=9606 GN=PKD1 PE=1 SV=3
15	Q9TW65	0.18	38.5	3674	0.049	0.014	DMD_CAEEL Dystrophin-1 OS=Caenorhabditis elegans OX=6239 GN=dys-1 PE=1 SV=2
16	L0MN91	0.22	38.1	8866	0.059	0.007	L0MN91_DROME Bent, isoform I OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1
17	X2JD89	0.22	38.1	8602	0.059	0.007	X2JD89_DROME Bent, isoform J OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1
18	H9G352	0.23	38.1	2193	0.058	0.028	H9G352_CAEEL Basement membrane proteoglycan OS=Caenorhabditis elegans OX=6239 GN=unc-52 PE=1 SV=1
19	D1YSG0	0.24	38.1	8933	0.059	0.007	D1YSG0_DROME Bent, isoform F OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1
20	H9G350	0.24	38.1	2479	0.058	0.025	H9G350_CAEEL Basement membrane proteoglycan OS=Caenorhabditis elegans OX=6239 GN=unc-52 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19077 Big_13	0.0047	28.8	Bacterial Ig-like domain
2	PF17963 Big_9	4.7e-07	41.7	Bacterial Ig domain
3	PF00028 Cadherin	0.21	23.3	Cadherin domain
4	PF17892 Cadherin_5	92	14.3	Cadherin-like domain
5	PF15418 DUF4625	2e-05	36.3	Domain of unknown function (DUF4625)
6	PF16389 DUF4998	0.62	21.1	Domain of unknown function
7	PF16403 DUF5011	0.033	25.6	Domain of unknown function (DUF5011)
8	PF16405 DUF5013	8.6	17.9	Domain of unknown function (DUF5013)
9	PF05345 He_PIG	0.007	28.2	Putative Ig domain
10	PF18981 InlK_D3	89	14.6	Internalin K domain (D3/D4)
11	PF07502 MANEC	2e+02	13.6	MANEC domain
12	PF00801 PKD	3.5e-09	47.7	PKD domain
13	PF18911 PKD_4	9.8e-24	94.6	PKD domain
14	PF18962 Por_Secre_tail	11	17.7	Secretion system C-terminal sorting domain
15	PF02010 REJ	7.3e-11	53.2	REJ domain
16	PF13908 Shisa	10	17.7	Wnt and FGF inhibitory regulator
17	PF14163 SieB	78	14.2	Super-infection exclusion protein B
18	PF17747 VID27_PH	20	16.9	VID27 PH-like domain
19	PF14524 Wzt_C	2.7	19.5	Wzt C-terminal domain
20	PF07495 Y_Y_Y	1.7e-11	55.2	Y_Y_Y domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367459

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367715	0.928	Doublecortin domain-containing protein 2
2	9606.ENSP00000323275	0.913	Dynein assembly factor 4, axonemal
3	9606.ENSP00000230048	0.814	Acyl-coenzyme A thioesterase 13
4	9606.ENSP00000420321	0.812	Roundabout homolog 1
5	9606.ENSP00000292807	0.811	AP-2 complex subunit mu
6	9606.ENSP00000318690	0.783	GC-rich sequence DNA-binding factor 2
7	9606.ENSP00000367440	0.765	Tyrosyl-DNA phosphodiesterase 2
8	9606.ENSP00000397925	0.757	Calcium-transporting ATPase type 2C member 2
9	9606.ENSP00000446100	0.755	C-Maf-inducing protein
10	9606.ENSP00000377486	0.745	Mitochondrial ribosomal protein L19
11	9606.ENSP00000354778	0.710	Contactin-associated protein-like 2
12	9606.ENSP00000386200	0.686	Forkhead box protein P2
13	9606.ENSP00000266037	0.675	Dedicator of cytokinesis protein 3
14	9606.ENSP00000367739	0.645	Neurensin-1
15	9606.ENSP00000411099	0.638	Serine/threonine-protein kinase tousled-like 1
16	9606.ENSP00000482835	0.608	AP-2 complex subunit beta
17	9606.ENSP00000333568	0.607	Serine/threonine-protein kinase D1
18	9606.ENSP00000327694	0.605	AP-2 complex subunit alpha-2
19	9606.ENSP00000351926	0.605	AP-2 complex subunit alpha-1
20	9606.ENSP00000263270	0.600	AP-2 complex subunit sigma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.982	cellular process
GO:0032501	0.959	multicellular organismal process
GO:0048523	0.952	negative regulation of cellular process
GO:0050793	0.945	regulation of developmental process
GO:0030308	0.928	negative regulation of cell growth
GO:0071840	0.918	cellular component organization or biogenesis
GO:0050771	0.917	negative regulation of axonogenesis
GO:1903034	0.916	regulation of response to wounding
GO:0061387	0.912	regulation of extent of cell growth
GO:0030517	0.898	negative regulation of axon extension
GO:0032102	0.897	negative regulation of response to external stimulus
GO:0070570	0.895	regulation of neuron projection regeneration
GO:1903035	0.885	negative regulation of response to wounding
GO:0070571	0.857	negative regulation of neuron projection regeneration
GO:0048679	0.852	regulation of axon regeneration
GO:0032502	0.845	developmental process
GO:0048856	0.841	anatomical structure development
GO:0007275	0.796	multicellular organism development
GO:0048518	0.698	positive regulation of biological process
GO:0048522	0.676	positive regulation of cellular process
GO:0050896	0.515	response to stimulus
GO:0023051	0.513	regulation of signaling
GO:0010646	0.407	regulation of cell communication
GO:0048681	0.343	negative regulation of axon regeneration
GO:0048731	0.328	system development
GO:0009966	0.307	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0031410	0.995	cytoplasmic vesicle
GO:0005886	0.990	plasma membrane
GO:0031090	0.957	organelle membrane
GO:0098588	0.939	bounding membrane of organelle
GO:0030659	0.908	cytoplasmic vesicle membrane
GO:0045334	0.904	clathrin-coated endocytic vesicle
GO:0030666	0.904	endocytic vesicle membrane
GO:0030665	0.902	clathrin-coated vesicle membrane
GO:0030669	0.890	clathrin-coated endocytic vesicle membrane
GO:0005768	0.883	endosome
GO:0005769	0.777	early endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]