StarFunc result for job id Q5VV63

User Input

>input (1379 residues)
METGGRARTGTPQPAAPGVWRARPAGGGGGGASSWLLDGNSWLLCYGFLYLALYAQVSQS
KPCERTGSCFSGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCT
WLIEGYPNAVLRLRFNHFATECSWDHMYVYDGDSIYAPLIAVLSGLIVPEIRGNETVPEV
VTTSGYALLHFFSDAAYNLTGFNIFYSINSCPNNCSGHGKCTTSVSVPSQVYCECDKYWK
GEACDIPYCKANCGSPDHGYCDLTGEKLCVCNDSWQGPDCSLNVPSTESYWILPNVKPFS
PSVGRASHKAVLHGKFMWVIGGYTFNYSSFQMVLNYNLESSIWNVGTPSRGPLQRYGHSL
ALYQENIFMYGGRIETNDGNVTDELWVFNIHSQSWSTKTPTVLGHGQQYAVEGHSAHIME
LDSRDVVMIIIFGYSAIYGYTSSIQEYHISSNTWLVPETKGAIVQGGYGHTSVYDEITKS
IYVHGGYKALPGNKYGLVDDLYKYEVNTKTWTILKESGFARYLHSAVLINGAMLIFGGNT
HNDTSLSNGAKCFSADFLAYDIACDEWKILPKPNLHRDVNRFGHSAVVINGSMYIFGGFS
SVLLNDILVYKPPNCKAFRDEELCKNAGPGIKCVWNKNHCESWESGNTNNILRAKCPPKT
AASDDRCYRYADCASCTANTNGCQWCDDKKCISANSNCSMSVKNYTKCHVRNEQICNKLT
SCKSCSLNLNCQWDQRQQECQALPAHLCGEGWSHIGDACLRVNSSRENYDNAKLYCYNLS
GNLASLTTSKEVEFVLDEIQKYTQQKVSPWVGLRKINISYWGWEDMSPFTNTTLQWLPGE
PNDSGFCAYLERAAVAGLKANPCTSMANGLVCEKPVVSPNQNARPCKKPCSLRTSCSNCT
SNGMECMWCSSTKRCVDSNAYIISFPYGQCLEWQTATCSPQNCSGLRTCGQCLEQPGCGW
CNDPSNTGRGHCIEGSSRGPMKLIGMHHSEMVLDTNLCPKEKNYEWSFIQCPACQCNGHS
TCINNNVCEQCKNLTTGKQCQDCMPGYYGDPTNGGQCTACTCSGHANICHLHTGKCFCTT
KGIKGDQCQLCDSENRYVGNPLRGTCYYSLLIDYQFTFSLLQEDDRHHTAINFIANPEQS
NKNLDISINASNNFNLNITWSVGSTAGTISGEETSIVSKNNIKEYRDSFSYEKFNFRSNP
NITFYVYVSNFSWPIKIQIAFSQHNTIMDLVQFFVTFFSCFLSLLLVAAVVWKIKQTCWA
SRRREQLLRERQQMASRPFASVDVALEVGAEQTEFLRGPLEGAPKPIAIEPCAGNRAAVL
TVFLCLPRGSSGAPPPGQSGLAIASALIDISQQKASDSKDKTSGVRNRKHLSTRQGTCV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8Q662	0.770	0.766	0.000	1386	0.571	0.568	A0A2R8Q662.pdb.gz
2	AFDB:Q6A051	0.885	0.886	0.000	1378	0.959	0.960	Q6A051.pdb.gz	ATRN1_MOUSE Attractin-like protein 1 OS=Mus musculus OX=10090 GN=Atrnl1 PE=1 SV=2
3	AFDB:Q99J86	0.759	0.733	0.000	1432	0.598	0.575	Q99J86.pdb.gz	ATRN_RAT Attractin OS=Rattus norvegicus OX=10116 GN=Atrn PE=2 SV=1
4	AFDB:Q9VB20	0.701	0.729	0.000	1323	0.360	0.375	Q9VB20.pdb.gz	Q9VB20_DROME Distracted, isoform B OS=Drosophila melanogaster OX=7227 GN=dsd PE=4 SV=2
5	AFDB:Q8VEM9	0.202	0.690	2.136E-21	382	0.057	0.207	Q8VEM9.pdb.gz	KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus OX=10090 GN=Klhdc3 PE=2 SV=1
6	AFDB:Q8N653	0.203	0.327	6.013E-21	840	0.056	0.092	Q8N653.pdb.gz	LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens OX=9606 GN=LZTR1 PE=1 SV=2
7	PDB:5gq0A	0.203	0.757	3.154E-20	338	0.047	0.192	5gq0A.pdb.gz
8	AFDB:Q10AZ7	0.206	0.543	7.992E-20	501	0.058	0.160	Q10AZ7.pdb.gz	GPA3_ORYSJ Protein GLUTELIN PRECURSOR ACCUMULATION 3 OS=Oryza sativa subsp. japonica OX=39947 GN=GPA3 PE=1 SV=1
9	AFDB:Q54C94	0.202	0.245	4.888E-19	1127	0.055	0.067	Q54C94.pdb.gz	GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum OX=44689 GN=gefF PE=2 SV=1
10	PDB:5gqtA	0.201	0.551	5.717E-19	470	0.057	0.166	5gqtA.pdb.gz
11	AFDB:P87061	0.199	0.238	1.376E-18	1147	0.047	0.057	P87061.pdb.gz	TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tea1 PE=1 SV=1
12	AFDB:Q7Z6M1	0.190	0.651	5.015E-18	372	0.052	0.194	Q7Z6M1.pdb.gz	RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens OX=9606 GN=RABEPK PE=1 SV=1
13	PDB:2uvkB	0.192	0.690	5.020E-14	349	0.036	0.140	2uvkB.pdb.gz
14	PDB:2zwaB	0.192	0.372	1.274E-13	683	0.042	0.085	2zwaB.pdb.gz	Structural basis of tRNA modification with CO2 fixation and methylation by wybutosine synthesizing enzyme TYW4.
15	PDB:6oemB	0.191	0.645	3.404E-11	346	0.030	0.121	6oemB.pdb.gz	Cutting antiparallel DNA strands in a single active site.
16	PDB:6dbjD	0.192	0.645	1.063E-10	352	0.033	0.131	6dbjD.pdb.gz	DNA melting initiates the RAG catalytic pathway.
17	PDB:1qddA	0.092	0.780	3.872E-8	144	0.030	0.285	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
18	PDB:7wz8A	0.089	0.627	4.641E-7	180	0.022	0.172	7wz8A.pdb.gz
19	PDB:5y31B	0.146	0.334	7.393E-7	511	0.024	0.065	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
20	PDB:1gz2A	0.087	0.765	2.308E-6	139	0.022	0.223	1gz2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B8JI13	0.0	1617	1345	0.557	0.571	B8JI13_DANRE Attractin OS=Danio rerio OX=7955 GN=si:dkey-259n11.1 PE=1 SV=1
2	O75882	0.0	1705	1429	0.593	0.572	ATRN_HUMAN Attractin OS=Homo sapiens OX=9606 GN=ATRN PE=1 SV=2
3	Q6A051	0.0	2748	1378	0.960	0.961	ATRN1_MOUSE Attractin-like protein 1 OS=Mus musculus OX=10090 GN=Atrnl1 PE=1 SV=2
4	Q99J86	0.0	1695	1432	0.587	0.565	ATRN_RAT Attractin OS=Rattus norvegicus OX=10116 GN=Atrn PE=2 SV=1
5	Q9WU60	0.0	1698	1428	0.587	0.567	ATRN_MOUSE Attractin OS=Mus musculus OX=10090 GN=Atrn PE=1 SV=3
6	Q9VB20	4.00e-140	464	1323	0.202	0.210	Q9VB20_DROME Distracted, isoform B OS=Drosophila melanogaster OX=7227 GN=dsd PE=4 SV=2
7	Q960R8	1.15e-131	439	1232	0.191	0.214	Q960R8_DROME LD38671p OS=Drosophila melanogaster OX=7227 GN=dsd PE=2 SV=1
8	F1QBZ9	2.70e-64	244	2870	0.122	0.059	F1QBZ9_DANRE Multiple EGF-like-domains 8 OS=Danio rerio OX=7955 GN=megf8 PE=4 SV=2
9	Q7Z7M0	2.48e-56	218	2845	0.125	0.061	MEGF8_HUMAN Multiple epidermal growth factor-like domains protein 8 OS=Homo sapiens OX=9606 GN=MEGF8 PE=1 SV=2
10	P60882	3.92e-55	214	2789	0.123	0.061	MEGF8_MOUSE Multiple epidermal growth factor-like domains protein 8 OS=Mus musculus OX=10090 GN=Megf8 PE=1 SV=2
11	Q9BQ90	4.55e-13	75.1	382	0.049	0.175	KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens OX=9606 GN=KLHDC3 PE=1 SV=1
12	Q8VEM9	1.33e-12	73.6	382	0.049	0.175	KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus OX=10090 GN=Klhdc3 PE=2 SV=1
13	Q9MA55	9.92e-12	72.0	668	0.052	0.108	ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=ACBP4 PE=1 SV=1
14	Q62381	3.81e-11	70.5	1013	0.038	0.051	TLL1_MOUSE Tolloid-like protein 1 OS=Mus musculus OX=10090 GN=Tll1 PE=1 SV=1
15	Q9V410	3.88e-11	70.5	975	0.049	0.069	LZTR1_DROME Leucine-zipper-like transcriptional regulator 1 homolog OS=Drosophila melanogaster OX=7227 GN=Lztr1 PE=1 SV=1
16	Q9S7W4	1.68e-10	66.6	329	0.051	0.213	Q9S7W4_ARATH AT3g07720/F17A17_6 OS=Arabidopsis thaliana OX=3702 GN=F17A17.6 PE=1 SV=1
17	O43897	2.01e-10	68.2	1013	0.038	0.052	TLL1_HUMAN Tolloid-like protein 1 OS=Homo sapiens OX=9606 GN=TLL1 PE=1 SV=1
18	Q8RWD9	3.61e-10	67.0	648	0.052	0.111	ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana OX=3702 GN=ACBP5 PE=1 SV=1
19	O57460	4.96e-09	63.5	1022	0.030	0.041	TLL1_DANRE Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio OX=7955 GN=tll1 PE=2 SV=1
20	G5EAY1	1.09e-08	62.4	1474	0.061	0.057	G5EAY1_EMENI Uncharacterized protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=teaA PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00431 CUB	1e-07	43.6	CUB domain
2	PF07974 EGF_2	0.38	22.5	EGF-like domain
3	PF01344 Kelch_1	1.6e-18	77.3	Kelch motif
4	PF07646 Kelch_2	1.7e-07	42.2	Kelch motif
5	PF13415 Kelch_3	5.7e-12	56.9	Galactose oxidase, central domain
6	PF13418 Kelch_4	2.6e-14	64.2	Galactose oxidase, central domain
7	PF13854 Kelch_5	2.7e-23	92.6	Kelch motif
8	PF13964 Kelch_6	8.5e-14	62.5	Kelch motif
9	PF00053 Laminin_EGF	2.4	19.7	Laminin EGF domain
10	PF00059 Lectin_C	9.3e-14	63.4	Lectin C-type domain
11	PF01437 PSI	1.1e-14	66.0	Plexin repeat
12	PF17205 PSI_integrin	16	16.6	Integrin plexin domain
13	PF16311 TMEM100	25	16.0	Transmembrane protein 100

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347152

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000299766	0.746	Melanocortin receptor 4
2	9606.ENSP00000451605	0.647	Melanocyte-stimulating hormone receptor
3	9606.ENSP00000358251	0.645	Protein FAM160B1
4	9606.ENSP00000298746	0.627	Probable tRNA pseudouridine synthase 1
5	9606.ENSP00000262370	0.621	E3 ubiquitin-protein ligase MGRN1
6	9606.ENSP00000310832	0.559	Cathepsin F
7	9606.ENSP00000411124	0.520	Brain-enriched guanylate kinase-associated protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.655	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0050896	0.822	response to stimulus
GO:0007165	0.779	signal transduction
GO:0007186	0.532	G protein-coupled receptor signaling pathway
GO:0008152	0.333	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0005737	0.992	cytoplasm
GO:0043227	0.988	membrane-bounded organelle
GO:0005576	0.938	extracellular region
GO:0031982	0.936	vesicle
GO:0070062	0.898	extracellular exosome
GO:0043231	0.727	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]