StarFunc result for job id Q5VV67

User Input

>input (1664 residues)
MAARRGRRDGVAPPPSGGPGPDPGGGARGSGWGSRSQAPYGTLGAVSGGEQVLLHEEAGD
SGFVSLSRLGPSLRDKDLEMEELMLQDETLLGTMQSYMDASLISLIEDFGSLGESRLSLE
DQNEVSLLTALTEILDNADSENLSPFDSIPDSELLVSPREGSSLHKLLTLSRTPPERDLI
TPVDPLGPSTGSSRGSGVEMSLPDPSWDFSPPSFLETSSPKLPSWRPPRSRPRWGQSPPP
QQRSDGEEEEEVASFSGQILAGELDNCVSSIPDFPMHLACPEEEDKATAAEMAVPAAGDE
SISSLSELVRAMHPYCLPNLTHLASLEDELQEQPDDLTLPEGCVVLEIVGQAATAGDDLE
IPVVVRQVSPGPRPVLLDDSLETSSALQLLMPTLESETEAAVPKVTLCSEKEGLSLNSEE
KLDSACLLKPREVVEPVVPKEPQNPPANAAPGSQRARKGRKKKSKEQPAACVEGYARRLR
SSSRGQSTVGTEVTSQVDNLQKQPQEELQKESGPLQGKGKPRAWARAWAAALENSSPKNL
ERSAGQSSPAKEGPLDLYPKLADTIQTNPIPTHLSLVDSAQASPMPVDSVEADPTAVGPV
LAGPVPVDPGLVDLASTSSELVEPLPAEPVLINPVLADSAAVDPAVVPISDNLPPVDAVP
SGPAPVDLALVDPVPNDLTPVDPVLVKSRPTDPRRGAVSSALGGSAPQLLVESESLDPPK
TIIPEVKEVVDSLKIESGTSATTHEARPRPLSLSEYRRRRQQRQAETEERSPQPPTGKWP
SLPETPTGLADIPCLVIPPAPAKKTALQRSPETPLEICLVPVGPSPASPSPEPPVSKPVA
SSPTEQVPSQEMPLLARPSPPVQSVSPAVPTPPSMSAALPFPAGGLGMPPSLPPPPLQPP
SLPLSMGPVLPDPFTHYAPLPSWPCYPHVSPSGYPCLPPPPTVPLVSGTPGAYAVPPTCS
VPWAPPPAPVSPYSSTCTYGPLGWGPGPQHAPFWSTVPPPPLPPASIGRAVPQPKMESRG
TPAGPPENVLPLSMAPPLSLGLPGHGAPQTEPTKVEVKPVPASPHPKHKVSALVQSPQMK
ALACVSAEGVTVEEPASERLKPETQETRPREKPPLPATKAVPTPRQSTVPKLPAVHPARL
RKLSFLPTPRTQGSEDVVQAFISEIGIEASDLSSLLEQFEKSEAKKECPPPAPADSLAVG
NSGGVDIPQEKRPLDRLQAPELANVAGLTPPATPPHQLWKPLAAVSLLAKAKSPKSTAQE
GTLKPEGVTEAKHPAAVRLQEGVHGPSRVHVGSGDHDYCVRSRTPPKKMPALVIPEVGSR
WNVKRHQDITIKPVLSLGPAAPPPPCIAASREPLDHRTSSEQADPSAPCLAPSSLLSPEA
SPCRNDMNTRTPPEPSAKQRSMRCYRKACRSASPSSQGWQGRRGRNSRSVSSGSNRTSEA
SSSSSSSSSSSRSRSRSLSPPHKRWRRSSCSSSGRSRRCSSSSSSSSSSSSSSSSSSSSR
SRSRSPSPRRRSDRRRRYSSYRSHDHYQRQRVLQKERAIEERRVVFIGKIPGRMTRSELK
QRFSVFGEIEECTIHFRVQGDNYGFVTYRYAEEAFAAIESGHKLRQADEQPFDLCFGGRR
QFCKRSYSDLDSNREDFDPAPVKSKFDSLDFDTLLKQAQKNLRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VV67	1.000	1.000	0.000	1664	1.000	1.000	Q5VV67.pdb.gz	PPRC1_HUMAN Peroxisome proliferator-activated receptor gamma coactivator-related protein 1 OS=Homo sapiens OX=9606 GN=PPRC1 PE=1 SV=1
2	AFDB:A0A0R4IJ26	0.056	0.054	2.374E-6	1760	0.158	0.149	A0A0R4IJ26.pdb.gz
3	AFDB:D3ZRA6	0.051	0.050	1.687E-5	1683	0.158	0.156	D3ZRA6.pdb.gz	D3ZRA6_RAT Trinucleotide repeat containing adaptor 6C OS=Rattus norvegicus OX=10116 GN=Tnrc6c PE=1 SV=4
4	PDB:3lqvB	0.049	0.608	3.092E-5	115	0.010	0.139	3lqvB.pdb.gz	Branch Recognition by SF3b14
5	AFDB:F1LV37	0.049	0.045	4.359E-5	1818	0.153	0.140	F1LV37.pdb.gz	F1LV37_RAT Trinucleotide repeat containing adaptor 6B OS=Rattus norvegicus OX=10116 GN=Tnrc6b PE=1 SV=3
6	PDB:6qx91K	0.049	0.362	5.464E-5	201	0.011	0.090	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
7	PDB:1hl6A	0.044	0.527	7.038E-5	119	0.011	0.160	1hl6A.pdb.gz
8	PDB:5xjcw	0.045	0.700	1.029E-4	91	0.011	0.209	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
9	PDB:5oobB	0.048	0.444	1.167E-4	152	0.009	0.099	5oobB.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
10	PDB:6n7pY	0.049	0.484	1.325E-4	138	0.010	0.123	6n7pY.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
11	PDB:5vsuA	0.048	0.197	1.818E-4	387	0.008	0.036	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
12	AFDB:Q3UHK8	0.053	0.048	1.868E-4	1896	0.154	0.136	Q3UHK8.pdb.gz	TNR6A_MOUSE Trinucleotide repeat-containing gene 6A protein OS=Mus musculus OX=10090 GN=Tnrc6a PE=1 SV=2
13	PDB:6gd1A	0.043	0.349	2.063E-4	190	0.012	0.105	6gd1A.pdb.gz
14	PDB:6n7pA	0.046	0.362	2.494E-4	186	0.015	0.134	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
15	PDB:6exnY	0.045	0.715	2.657E-4	87	0.010	0.195	6exnY.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
16	AFDB:F8VPZ9	0.036	0.038	5.475E-4	1578	0.160	0.169	F8VPZ9.pdb.gz	BICRA_MOUSE BRD4-interacting chromatin-remodeling complex-associated protein OS=Mus musculus OX=10090 GN=Bicra PE=1 SV=1
17	AFDB:Q9UPQ9	0.057	0.053	7.052E-4	1833	0.166	0.151	Q9UPQ9.pdb.gz	TNR6B_HUMAN Trinucleotide repeat-containing gene 6B protein OS=Homo sapiens OX=9606 GN=TNRC6B PE=1 SV=4
18	AFDB:Q96EV2	0.047	0.059	1.328E-3	1170	0.136	0.194	Q96EV2.pdb.gz	RBM33_HUMAN RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33 PE=1 SV=3
19	AFDB:Q8NDV7	0.053	0.046	2.346E-3	1962	0.151	0.128	Q8NDV7.pdb.gz	TNR6A_HUMAN Trinucleotide repeat-containing gene 6A protein OS=Homo sapiens OX=9606 GN=TNRC6A PE=1 SV=2
20	AFDB:Q8CGM2	0.044	0.041	3.653E-3	1859	0.157	0.140	Q8CGM2.pdb.gz	RP1L1_MOUSE Retinitis pigmentosa 1-like 1 protein OS=Mus musculus OX=10090 GN=Rp1l1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EVG6	0.0	2351	1400	0.723	0.859	E7EVG6_HUMAN PPARG related coactivator 1 OS=Homo sapiens OX=9606 GN=PPRC1 PE=1 SV=1
2	Q5VV67	0.0	3281	1664	1.000	1.000	PPRC1_HUMAN Peroxisome proliferator-activated receptor gamma coactivator-related protein 1 OS=Homo sapiens OX=9606 GN=PPRC1 PE=1 SV=1
3	X6R7H2	0.0	1261	631	0.379	1.000	X6R7H2_HUMAN PPARG related coactivator 1 OS=Homo sapiens OX=9606 GN=PPRC1 PE=1 SV=1
4	Q9QYK2	9.38e-52	199	796	0.054	0.113	PRGC1_RAT Peroxisome proliferator-activated receptor gamma coactivator 1-alpha OS=Rattus norvegicus OX=10116 GN=Ppargc1a PE=2 SV=1
5	Q9UBK2	1.55e-51	199	798	0.053	0.112	PRGC1_HUMAN Peroxisome proliferator-activated receptor gamma coactivator 1-alpha OS=Homo sapiens OX=9606 GN=PPARGC1A PE=1 SV=1
6	O70343	2.20e-50	195	797	0.052	0.109	PRGC1_MOUSE Peroxisome proliferator-activated receptor gamma coactivator 1-alpha OS=Mus musculus OX=10090 GN=Ppargc1a PE=1 SV=1
7	Q86YN6	5.83e-30	132	1023	0.038	0.062	PRGC2_HUMAN Peroxisome proliferator-activated receptor gamma coactivator 1-beta OS=Homo sapiens OX=9606 GN=PPARGC1B PE=1 SV=2
8	Q811R2	1.10e-25	118	1010	0.035	0.057	PRGC2_RAT Peroxisome proliferator-activated receptor gamma coactivator 1-beta OS=Rattus norvegicus OX=10116 GN=Ppargc1b PE=2 SV=2
9	Q8VHJ7	5.12e-25	115	1014	0.034	0.055	PRGC2_MOUSE Peroxisome proliferator-activated receptor gamma coactivator 1-beta OS=Mus musculus OX=10090 GN=Ppargc1b PE=1 SV=1
10	Q8IPM0	1.72e-22	107	1058	0.026	0.041	Q8IPM0_DROME Spargel, isoform D OS=Drosophila melanogaster OX=7227 GN=srl PE=4 SV=3
11	Q5U183	1.78e-22	107	1058	0.026	0.041	Q5U183_DROME RE24187p OS=Drosophila melanogaster OX=7227 GN=srl PE=2 SV=1
12	Q8IPM1	1.80e-22	107	1067	0.026	0.040	Q8IPM1_DROME FI18188p1 OS=Drosophila melanogaster OX=7227 GN=srl PE=2 SV=2
13	Q8IH74	2.76e-21	102	555	0.025	0.076	Q8IH74_DROME GH02708p OS=Drosophila melanogaster OX=7227 GN=srl PE=2 SV=1
14	H0Y713	8.26e-19	95.5	748	0.027	0.060	H0Y713_HUMAN PPARG coactivator 1 beta (Fragment) OS=Homo sapiens OX=9606 GN=PPARGC1B PE=1 SV=1
15	Q9NH72	0.058	40.4	690	0.020	0.048	Q9NH72_DROME Rasputin OS=Drosophila melanogaster OX=7227 GN=rin PE=2 SV=1
16	Q9VFT4	0.058	40.4	690	0.020	0.048	Q9VFT4_DROME AT27578p OS=Drosophila melanogaster OX=7227 GN=rin PE=1 SV=1
17	O22315	0.59	37.0	303	0.015	0.083	SR34_ARATH Serine/arginine-rich-splicing factor SR34 OS=Arabidopsis thaliana OX=3702 GN=SR34 PE=1 SV=1
18	A3AT67	1.3	36.2	684	0.015	0.037	A3AT67_ORYSJ Branchpoint-bridging protein OS=Oryza sativa subsp. japonica OX=39947 GN=OsJ_14553 PE=3 SV=1
19	A0A384N5Z8	1.7	35.8	707	0.010	0.023	A0A384N5Z8_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
20	P23246	1.7	35.8	707	0.010	0.023	SFPQ_HUMAN Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	0.00016	32.8	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000278070

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000420588	0.979	Transcription factor A, mitochondrial
2	9606.ENSP00000376924	0.966	Nuclear respiratory factor 1
3	9606.ENSP00000356134	0.953	Dimethyladenosine transferase 1, mitochondrial
4	9606.ENSP00000355471	0.948	Dimethyladenosine transferase 2, mitochondrial
5	9606.ENSP00000358563	0.855	H/ACA ribonucleoprotein complex subunit 4
6	9606.ENSP00000309555	0.842	Host cell factor 1
7	9606.ENSP00000346886	0.826	GA-binding protein alpha chain
8	9606.ENSP00000371858	0.811	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase
9	9606.ENSP00000212015	0.753	NAD-dependent protein deacetylase sirtuin-1
10	9606.ENSP00000220429	0.716	GA-binding protein subunit beta-1
11	9606.ENSP00000384851	0.700	Steroid hormone receptor ERR1
12	9606.ENSP00000264867	0.688	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
13	9606.ENSP00000426359	0.682	Multicilin
14	9606.ENSP00000297990	0.678	Nucleolar protein 6
15	9606.ENSP00000326806	0.676	Nuclear cap-binding protein subunit 2
16	9606.ENSP00000298746	0.653	Probable tRNA pseudouridine synthase 1
17	9606.ENSP00000385824	0.651	Forkhead box protein O3
18	9606.ENSP00000251588	0.647	Cytosolic Fe-S cluster assembly factor NARFL
19	9606.ENSP00000384262	0.628	Heparanase
20	9606.ENSP00000228318	0.599	Phosphate carrier protein, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.863	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0065007	0.988	biological regulation
GO:0071704	0.986	organic substance metabolic process
GO:0050789	0.980	regulation of biological process
GO:0019222	0.969	regulation of metabolic process
GO:0050794	0.966	regulation of cellular process
GO:0060255	0.957	regulation of macromolecule metabolic process
GO:0032501	0.954	multicellular organismal process
GO:0032502	0.912	developmental process
GO:0048518	0.854	positive regulation of biological process
GO:0044238	0.829	primary metabolic process
GO:0044237	0.797	cellular metabolic process
GO:0043170	0.790	macromolecule metabolic process
GO:0048522	0.786	positive regulation of cellular process
GO:0010468	0.780	regulation of gene expression
GO:0006807	0.718	nitrogen compound metabolic process
GO:0031323	0.676	regulation of cellular metabolic process
GO:0080090	0.644	regulation of primary metabolic process
GO:0051171	0.621	regulation of nitrogen compound metabolic process
GO:0048519	0.569	negative regulation of biological process
GO:0009893	0.532	positive regulation of metabolic process
GO:0010604	0.521	positive regulation of macromolecule metabolic process
GO:0031325	0.512	positive regulation of cellular metabolic process
GO:0050896	0.509	response to stimulus
GO:0009889	0.505	regulation of biosynthetic process
GO:0051173	0.500	positive regulation of nitrogen compound metabolic process
GO:0031326	0.498	regulation of cellular biosynthetic process
GO:0010556	0.495	regulation of macromolecule biosynthetic process
GO:0019219	0.486	regulation of nucleobase-containing compound metabolic process
GO:0071840	0.454	cellular component organization or biogenesis
GO:0051252	0.421	regulation of RNA metabolic process
GO:0048856	0.408	anatomical structure development
GO:0016043	0.403	cellular component organization
GO:0045935	0.382	positive regulation of nucleobase-containing compound metabolic process
GO:0048523	0.366	negative regulation of cellular process
GO:2001141	0.349	regulation of RNA biosynthetic process
GO:0010557	0.342	positive regulation of macromolecule biosynthetic process
GO:0006355	0.340	regulation of DNA-templated transcription
GO:0051254	0.336	positive regulation of RNA metabolic process
GO:0031328	0.315	positive regulation of cellular biosynthetic process
GO:0009892	0.303	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.456	protein-containing complex
GO:0005737	0.401	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]