StarFunc result for job id Q5VVH2

User Input

>input (108 residues)
MGVHVETISPGDWRTFPKRSQTCVMHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVVQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1fklA	0.977	0.986	2.985E-19	107	0.917	0.925	1fklA.pdb.gz	Comparative X-ray structures of the major binding protein for the immunosuppressant FK506 (tacrolimus) in unliganded form and in complex with FK506 and rapamycin.
2	AFDB:Q0VDC6	0.995	0.742	3.989E-19	145	0.954	0.710	Q0VDC6.pdb.gz	Q0VDC6_HUMAN peptidylprolyl isomerase OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=1
3	AFDB:O42123	0.997	0.997	8.985E-19	108	0.796	0.796	O42123.pdb.gz	FKB1A_XENLA Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Xenopus laevis OX=8355 GN=fkbp1a PE=3 SV=3
4	PDB:2nd5A	0.967	0.942	1.434E-18	111	0.954	0.928	2nd5A.pdb.gz
5	AFDB:Q8AVL7	0.996	0.810	1.462E-18	133	0.796	0.647	Q8AVL7.pdb.gz	Q8AVL7_XENLA peptidylprolyl isomerase (Fragment) OS=Xenopus laevis OX=8355 GN=FKBP1B PE=2 SV=1
6	AFDB:C1BFZ3	0.996	0.996	2.513E-18	108	0.750	0.750	C1BFZ3.pdb.gz	C1BFZ3_ONCMY peptidylprolyl isomerase OS=Oncorhynchus mykiss OX=8022 GN=FKB1A PE=2 SV=1
7	PDB:4c02B	0.986	0.986	2.602E-18	108	0.796	0.796	4c02B.pdb.gz	Crystal Structure of Human Acvr1 (Alk2) in Complex with Fkbp12.6 And Dorsomorphin
8	AFDB:A0A060WZU7	0.994	0.994	2.800E-18	108	0.769	0.769	A0A060WZU7.pdb.gz	A0A060WZU7_ONCMY peptidylprolyl isomerase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00006391001 PE=4 SV=1
9	AFDB:P97534	0.995	0.995	3.293E-18	108	0.787	0.787	P97534.pdb.gz	FKB1B_RAT Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Rattus norvegicus OX=10116 GN=Fkbp1b PE=1 SV=3
10	AFDB:P48375	0.993	0.993	1.763E-17	108	0.713	0.713	P48375.pdb.gz	FKB12_DROME Peptidyl-prolyl cis-trans isomerase Fkbp12 OS=Drosophila melanogaster OX=7227 GN=Fkbp12 PE=3 SV=2
11	AFDB:O94746	0.985	0.985	4.537E-16	108	0.593	0.593	O94746.pdb.gz	FKBP_CRYNH FK506-binding protein 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=FRR1 PE=1 SV=1
12	AFDB:Q57WF7	0.975	0.940	2.180E-15	112	0.481	0.464	Q57WF7.pdb.gz	Q57WF7_TRYB2 peptidylprolyl isomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.650 PE=1 SV=1
13	AFDB:Q6KBA8	0.979	0.979	3.548E-15	108	0.602	0.602	Q6KBA8.pdb.gz	FKB1A_EMENI FK506-binding protein 1A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=fprA PE=3 SV=1
14	PDB:6tz8C	0.965	0.939	1.422E-14	111	0.528	0.514	6tz8C.pdb.gz	Harnessing calcineurin-FK506-FKBP12 crystal structures from invasive fungal pathogens to develop antifungal agents.
15	PDB:7u0sA	0.976	0.851	1.967E-14	124	0.556	0.484	7u0sA.pdb.gz	Structure-Guided Synthesis of FK506 and FK520 Analogs with Increased Selectivity Exhibit In Vivo Therapeutic Efficacy against Cryptococcus.
16	PDB:7zw0sk	0.949	0.900	6.830E-14	114	0.546	0.518	7zw0sk.pdb.gz	Sensing of individual stalled 80S ribosomes by Fap1 for nonfunctional rRNA turnover.
17	PDB:5hw8B	0.935	0.830	3.860E-13	122	0.472	0.418	5hw8B.pdb.gz	Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
18	PDB:5njxA	0.964	0.257	5.780E-12	413	0.435	0.114	5njxA.pdb.gz	Combined x-ray crystallography and computational modeling approach to investigate the Hsp90 C-terminal peptide binding to FKBP51.
19	PDB:4mspA	0.910	0.533	1.048E-11	189	0.361	0.206	4mspA.pdb.gz	Structure of human peptidyl-prolyl cis-trans isomerase FKBP22 containing two EF-hand motifs.
20	PDB:2mphA	0.898	0.447	1.616E-11	224	0.417	0.201	2mphA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P62942	7.03e-74	216	108	0.954	0.954	FKB1A_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2
2	P62943	7.03e-74	216	108	0.954	0.954	FKB1A_RABIT Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Oryctolagus cuniculus OX=9986 GN=FKBP1A PE=1 SV=2
3	Q0VDC6	7.30e-73	214	145	0.954	0.710	Q0VDC6_HUMAN peptidylprolyl isomerase OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=1
4	P18203	2.75e-72	212	108	0.926	0.926	FKB1A_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Bos taurus OX=9913 GN=FKBP1A PE=1 SV=2
5	P26883	3.48e-71	209	108	0.926	0.926	FKB1A_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Mus musculus OX=10090 GN=Fkbp1a PE=1 SV=2
6	Q62658	3.48e-71	209	108	0.926	0.926	FKB1A_RAT Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Rattus norvegicus OX=10116 GN=Fkbp1a PE=1 SV=3
7	B5G2R5	3.59e-71	209	108	0.889	0.889	B5G2R5_TAEGU peptidylprolyl isomerase OS=Taeniopygia guttata OX=59729 PE=2 SV=1
8	Q90ZG0	3.59e-71	209	108	0.889	0.889	Q90ZG0_CHICK peptidylprolyl isomerase OS=Gallus gallus OX=9031 GN=FKBP12 PE=2 SV=1
9	Q8AVL7	2.47e-65	195	133	0.796	0.647	Q8AVL7_XENLA peptidylprolyl isomerase (Fragment) OS=Xenopus laevis OX=8355 GN=FKBP1B PE=2 SV=1
10	Q5XG46	1.17e-64	192	108	0.796	0.796	Q5XG46_XENLA peptidylprolyl isomerase OS=Xenopus laevis OX=8355 GN=fkbp1b.S PE=2 SV=1
11	P68106	2.00e-64	192	108	0.796	0.796	FKB1B_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Homo sapiens OX=9606 GN=FKBP1B PE=1 SV=2
12	P97534	1.38e-63	190	108	0.787	0.787	FKB1B_RAT Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Rattus norvegicus OX=10116 GN=Fkbp1b PE=1 SV=3
13	Q9Z2I2	2.19e-63	189	108	0.787	0.787	FKB1B_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Mus musculus OX=10090 GN=Fkbp1b PE=1 SV=3
14	Q8QGU2	2.36e-63	189	108	0.778	0.778	Q8QGU2_CHICK peptidylprolyl isomerase OS=Gallus gallus OX=9031 GN=FKBP12.6 PE=2 SV=1
15	Q8HYX6	2.72e-63	189	108	0.787	0.787	FKB1B_RABIT Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Oryctolagus cuniculus OX=9986 GN=FKBP1B PE=3 SV=3
16	O42123	5.95e-62	186	108	0.796	0.796	FKB1A_XENLA Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Xenopus laevis OX=8355 GN=fkbp1a PE=3 SV=3
17	A0A060WZU7	2.56e-61	184	108	0.769	0.769	A0A060WZU7_ONCMY peptidylprolyl isomerase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00006391001 PE=4 SV=1
18	C1BFZ3	4.75e-59	178	108	0.750	0.750	C1BFZ3_ONCMY peptidylprolyl isomerase OS=Oncorhynchus mykiss OX=8022 GN=FKB1A PE=2 SV=1
19	C1BH42	4.22e-58	176	108	0.741	0.741	C1BH42_ONCMY peptidylprolyl isomerase OS=Oncorhynchus mykiss OX=8022 GN=FKB1A PE=2 SV=1
20	G1T0U7	2.52e-56	171	96	0.704	0.792	G1T0U7_RABIT peptidylprolyl isomerase OS=Oryctolagus cuniculus OX=9986 GN=FKBP1B PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00254 FKBP_C	2.1e-29	113.0	FKBP-type peptidyl-prolyl cis-trans isomerase
2	PF03707 MHYT	9.9e+02	11.3	Bacterial signalling protein N terminal repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359693

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354558	0.878	Serine/threonine-protein kinase mTOR
2	9606.ENSP00000225174	0.819	Peptidyl-prolyl cis-trans isomerase F, mitochondrial
3	9606.ENSP00000261313	0.815	Phosphatidylethanolamine-binding protein 1
4	9606.ENSP00000247970	0.770	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
5	9606.ENSP00000352608	0.756	Ryanodine receptor 1
6	9606.ENSP00000234310	0.747	Calcineurin subunit B type 1
7	9606.ENSP00000477980	0.746	WD repeat-containing protein 92
8	9606.ENSP00000378046	0.724	Peptidyl-prolyl cis-trans isomerase FKBP2
9	9606.ENSP00000419425	0.724	Peptidyl-prolyl cis-trans isomerase A
10	9606.ENSP00000355533	0.720	Ryanodine receptor 2
11	9606.ENSP00000300026	0.708	Peptidyl-prolyl cis-trans isomerase B
12	9606.ENSP00000377494	0.701	Transgelin-3
13	9606.ENSP00000439012	0.700	Acyl-CoA-binding protein
14	9606.ENSP00000355651	0.690	Ras-related protein Rab-4A
15	9606.ENSP00000335153	0.676	Heat shock protein HSP 90-alpha
16	9606.ENSP00000378323	0.644	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
17	9606.ENSP00000378306	0.642	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
18	9606.ENSP00000380878	0.642	Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
19	9606.ENSP00000263640	0.630	Activin receptor type-1
20	9606.ENSP00000360609	0.629	Heat shock protein HSP 90-beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.989	heterocyclic compound binding
GO:0097159	0.989	organic cyclic compound binding
GO:0003824	0.973	catalytic activity
GO:0140096	0.922	catalytic activity, acting on a protein
GO:0005527	0.913	macrolide binding
GO:0003755	0.822	peptidyl-prolyl cis-trans isomerase activity
GO:0033218	0.671	amide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0051049	0.993	regulation of transport
GO:0065009	0.974	regulation of molecular function
GO:0051282	0.932	regulation of sequestering of calcium ion
GO:0032412	0.930	regulation of monoatomic ion transmembrane transporter activity
GO:1904062	0.928	regulation of monoatomic cation transmembrane transport
GO:1903169	0.916	regulation of calcium ion transmembrane transport
GO:0051279	0.889	regulation of release of sequestered calcium ion into cytosol
GO:0009987	0.795	cellular process
GO:1901019	0.792	regulation of calcium ion transmembrane transporter activity
GO:0050896	0.640	response to stimulus
GO:2001257	0.612	regulation of cation channel activity
GO:0008152	0.467	metabolic process
GO:0071704	0.426	organic substance metabolic process
GO:0048519	0.391	negative regulation of biological process
GO:0006807	0.377	nitrogen compound metabolic process
GO:0044238	0.373	primary metabolic process
GO:0043170	0.368	macromolecule metabolic process
GO:0048518	0.321	positive regulation of biological process
GO:0048523	0.317	negative regulation of cellular process
GO:0019222	0.310	regulation of metabolic process
GO:0048583	0.305	regulation of response to stimulus
GO:1901564	0.302	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.992	endomembrane system
GO:0070013	0.947	intracellular organelle lumen
GO:0032991	0.928	protein-containing complex
GO:0005829	0.925	cytosol
GO:0005783	0.905	endoplasmic reticulum
GO:0016528	0.895	sarcoplasm
GO:0005634	0.825	nucleus
GO:0016529	0.823	sarcoplasmic reticulum
GO:0016020	0.799	membrane
GO:0031981	0.770	nuclear lumen
GO:0031984	0.747	organelle subcompartment
GO:0098827	0.734	endoplasmic reticulum subcompartment
GO:0014802	0.612	terminal cisterna
GO:0043232	0.484	intracellular non-membrane-bounded organelle
GO:0005654	0.471	nucleoplasm
GO:0031090	0.407	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16237	0.822	[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0)
EC:5.2.1.8	0.822	peptidylprolyl isomerase.

[back to server]