StarFunc result for job id Q5VVP1

User Input

>input (1343 residues)
MENLPFPLKLLSASSLNAPSSTPWVLDIFLTLVFALGFFFLLLPYLSYFHCDDPPSPSPG
KRKCPVGRRRRPRGRMKNHSLRAGRECPRGLEETSDLLSQLQSLLGPHLDKGDFGQLSGP
DPPGEVGERAPDGASQSSHEPMEDAAPILSPLASPDPQAKHPQDLASTPSPGPMTTSVSS
LSASQPPEPSLPLEHPSPEPPALFPHPPHTPDPLACSPPPPKGFTAPPLRDSTLITPSHC
DSVALPLGTVPQSLSPHEDLVASVPAISGLGGSNSHVSASSRWQETARTSCAFNSSVQQD
PLSRHPPETCQMEAGSLFLLSSDGQNVVGIQVTETAKVNIWEEKENVGSFTNQMTPEKHL
NSLGNLAKSLDAEQDTTNPKPFWNMGENSKQLPGPQKCSDPRLLQESFWKNYSQLFWGLP
SLHSESLVANAWVTDRSYTLQSPPFLFNEMSNVCPIQRETTMSPLLFQAQPLSHRQPFIS
STPQFLPTPMAQAEAQAHLQSSFPVLSPAFPSLIKNTGVACPASQNKVQALSLPETQHPE
WPLLRKQLEGRLALPSRVQKSQDVFSVSTPNLPQESLTSILPENFPVSPELRRQLEQHIK
KWIIQHWGNLGRIQESLDLMQLRDESPGTSQAKGKPSPWQSSTSTGESSKEAQKVKFQLE
RDLCPHLGQILGETPQNLSRDMKSFPRKVLGVTSEESERNLRKPLRSDSGSDLLRCTERT
HIENILKAHMGRNLGQTNEGLIPVRVRRSWLAVNQALPVSNTHVKTSNLAAPKSGKACVN
TAQVLSFLEPCTQQGLGAHIVRFWAKHRWGLPLRVLKPIQCFKLEKVSSLSLTQLAGPSS
ATCESGAGSEVEVDMFLRKPPMASLRKQVLTKASDHMPESLLASSPAWKQFQRAPRGIPS
WNDHGPLKPPPAGQEGRWPSKPLTYSLTGSTQQSRSLGAQSSKAGETREAVPQCRVPLET
CMLANLQATSEDVHGFEAPGTSKSSLHPRVSVSQDPRKLCLMEEVVSEFEPGMATKSETQ
PQVCAAVVLLPDGQASVVPHASENLVSQVPQGHLQSMPTGNMRASQELHDLMAARRSKLV
QEEPRNPNCQGSCKSQRPMFPPIHKSEKSRKPNLEKHEERLEGLRTPQLTPVRKTEDTHQ
DEGVQLLPSKKQPPSVSHFGENIKQFFQWIFSKKKSKPAPVTAESQKTVKNRSCVYSSSA
EAQGLMTAVGQMLDKKMSLCHAHHASKVNQHKQKFQAPVCGFPCNHRHLFYSEHGRILSY
AASSQQATLKSQGCPNRDRQIRNQQPLKSVRCNNEQWGLRHPQILHPKKAVSPVSPPQHW
PKTSGASSHHHHCPRHCLLWEGI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IWB4	0.145	0.145	0.000	1347	0.980	0.977	Q8IWB4.pdb.gz	S31A7_HUMAN Spermatogenesis-associated protein 31A7 OS=Homo sapiens OX=9606 GN=SPATA31A7 PE=1 SV=4
2	AFDB:O95785	0.036	0.030	1.264E-5	1651	0.170	0.138	O95785.pdb.gz	WIZ_HUMAN Protein Wiz OS=Homo sapiens OX=9606 GN=WIZ PE=1 SV=2
3	AFDB:Q8I398	0.049	0.034	2.409E-3	2112	0.113	0.072	Q8I398.pdb.gz	Q8I398_PLAF7 Nucleoporin NUP221, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0905100 PE=4 SV=1
4	AFDB:Q9DB00	0.042	0.031	2.964E-3	2260	0.140	0.083	Q9DB00.pdb.gz	GON4L_MOUSE GON-4-like protein OS=Mus musculus OX=10090 GN=Gon4l PE=1 SV=3
5	AFDB:P39769	0.037	0.033	5.519E-3	1589	0.162	0.137	P39769.pdb.gz	PHP_DROME Polyhomeotic-proximal chromatin protein OS=Drosophila melanogaster OX=7227 GN=ph-p PE=1 SV=2
6	AFDB:Q7TT18	0.038	0.038	7.796E-3	1306	0.137	0.141	Q7TT18.pdb.gz	MCAF1_MOUSE Activating transcription factor 7-interacting protein 1 OS=Mus musculus OX=10090 GN=Atf7ip PE=1 SV=1
7	AFDB:Q6AI39	0.048	0.054	9.592E-3	1079	0.126	0.157	Q6AI39.pdb.gz	BICRL_HUMAN BRD4-interacting chromatin-remodeling complex-associated protein-like OS=Homo sapiens OX=9606 GN=BICRAL PE=1 SV=2
8	AFDB:Q8CHP0	0.038	0.050	2.197E-2	950	0.134	0.189	Q8CHP0.pdb.gz	ZC3H3_MOUSE Zinc finger CCCH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Zc3h3 PE=1 SV=1
9	AFDB:F1QM29	0.044	0.042	2.523E-2	1413	0.095	0.090	F1QM29.pdb.gz	F1QM29_DANRE Retinitis pigmentosa GTPase regulator b OS=Danio rerio OX=7955 GN=rpgrb PE=4 SV=1
10	AFDB:M9NEB2	0.042	0.044	2.523E-2	1273	0.105	0.111	M9NEB2.pdb.gz	M9NEB2_DROME Myosin binding subunit, isoform O OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
11	PDB:5nrlG	0.029	0.070	2.871	372	0.016	0.056	5nrlG.pdb.gz	Structure of a pre-catalytic spliceosome.
12	PDB:6ahd9	0.032	0.163	8.670	165	0.014	0.115	6ahd9.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
13	PDB:6w6iF	0.038	0.077	9.290	605	0.008	0.018	6w6iF.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.
14	PDB:7ajuCL	0.026	0.040	9.290	808	0.010	0.017	7ajuCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:6hivCH	0.031	0.126	9.955	273	0.007	0.037	6hivCH.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IWB4	0.0	2655	1347	0.981	0.978	S31A7_HUMAN Spermatogenesis-associated protein 31A7 OS=Homo sapiens OX=9606 GN=SPATA31A7 PE=1 SV=4
2	B6VQA5	6.95e-151	486	1048	0.269	0.344	SPT31_RAT Spermatogenesis-associated protein 31 OS=Rattus norvegicus OX=10116 GN=Spata31 PE=1 SV=1
3	Q6ZU69	0.022	41.6	1335	0.018	0.018	S31F1_HUMAN Protein SPATA31F1 OS=Homo sapiens OX=9606 GN=SPATA31F1 PE=2 SV=4
4	Q6GQS8	0.047	40.4	569	0.048	0.112	Q6GQS8_MOUSE SPATA31 domain-containing protein OS=Mus musculus OX=10090 GN=Gm21093 PE=2 SV=1
5	F5H212	1.3	35.8	2717	0.032	0.016	F5H212_HUMAN HIVEP zinc finger 1 OS=Homo sapiens OX=9606 GN=HIVEP1 PE=1 SV=2
6	P15822	1.4	35.8	2718	0.032	0.016	ZEP1_HUMAN Zinc finger protein 40 OS=Homo sapiens OX=9606 GN=HIVEP1 PE=1 SV=4
7	P25940	2.4	35.0	1745	0.024	0.018	CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens OX=9606 GN=COL5A3 PE=1 SV=3
8	A0A024R7N1	8.1	33.1	970	0.019	0.027	A0A024R7N1_HUMAN GMIP (Fragment) OS=Homo sapiens OX=9606 GN=GMIP PE=4 SV=1
9	Q9P107	8.1	33.1	970	0.019	0.027	GMIP_HUMAN GEM-interacting protein OS=Homo sapiens OX=9606 GN=GMIP PE=1 SV=2
10	G3V608	8.9	33.1	896	0.029	0.044	G3V608_RAT Colony stimulating factor 2 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Csf2rb PE=4 SV=3
11	A0A8I6GE59	9.4	33.1	787	0.029	0.050	A0A8I6GE59_RAT Colony stimulating factor 2 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Csf2rb PE=4 SV=1
12	A6NFR6	9.6	32.7	353	0.041	0.156	CE060_HUMAN Uncharacterized protein C5orf60 OS=Homo sapiens OX=9606 GN=C5orf60 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15371 DUF4599	1.7e-18	78.0	Domain of unknown function (DUF4599)
2	PF14650 FAM75	8.6e-124	425.6	FAM75 family
3	PF04662 Luteo_PO	4.1e+02	12.0	Luteovirus P0 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329825

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000454370	0.758	Small lysine rich protein 1
2	9606.ENSP00000349891	0.709	Ankyrin repeat domain-containing protein 20A4
3	9606.ENSP00000383020	0.681	Putative zinc finger protein 705G

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.957	biological regulation
GO:0050789	0.873	regulation of biological process
GO:0050794	0.857	regulation of cellular process
GO:0009987	0.554	cellular process
GO:0060255	0.310	regulation of macromolecule metabolic process
GO:0080090	0.309	regulation of primary metabolic process
GO:0051171	0.309	regulation of nitrogen compound metabolic process
GO:0031323	0.306	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.997	cytoplasm
GO:0012505	0.981	endomembrane system
GO:0030141	0.947	secretory granule
GO:0005634	0.945	nucleus
GO:0001669	0.859	acrosomal vesicle
GO:0070013	0.377	intracellular organelle lumen
GO:0031981	0.362	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]