StarFunc result for job id Q5VVQ6

User Input

>input (348 residues)
MFGPAKGRHFGVHPAPGFPGGVSQQAAGTKAGPAGAWPVGSRTDTMWRLRCKAKDGTHVL
QGLSSRTRVRELQGQIAAITGIAPGGQRILVGYPPECLDLSNGDTILEDLPIQSGDMLII
EEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAP
EMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVD
TQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALEL
ADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VVQ6	1.000	1.000	1.413E-72	348	1.000	1.000	Q5VVQ6.pdb.gz	OTU1_HUMAN Ubiquitin thioesterase OTU1 OS=Homo sapiens OX=9606 GN=YOD1 PE=1 SV=1
2	AFDB:Q9VRJ9	0.550	0.552	4.531E-39	347	0.399	0.401	Q9VRJ9.pdb.gz	OTU1_DROME Ubiquitin thioesterase Otu1 OS=Drosophila melanogaster OX=7227 GN=Yod1 PE=2 SV=1
3	AFDB:Q55BI3	0.553	0.590	5.794E-36	325	0.356	0.382	Q55BI3.pdb.gz	OTU1_DICDI Ubiquitin thioesterase OTU1 OS=Dictyostelium discoideum OX=44689 GN=yod1 PE=3 SV=1
4	AFDB:O13974	0.518	0.547	6.642E-30	329	0.284	0.301	O13974.pdb.gz	OTU1_SCHPO Putative ubiquitin thioesterase otu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=otu1 PE=1 SV=1
5	AFDB:P43558	0.468	0.535	1.363E-26	301	0.256	0.296	P43558.pdb.gz	OTU1_YEAST Ubiquitin thioesterase OTU1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OTU1 PE=1 SV=1
6	AFDB:Q9LPT6	0.542	0.895	2.320E-26	208	0.276	0.462	Q9LPT6.pdb.gz	OTU2_ARATH OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 2 OS=Arabidopsis thaliana OX=3702 GN=OTU2 PE=1 SV=1
7	AFDB:Q38A95	0.437	0.568	9.617E-25	265	0.210	0.275	Q38A95.pdb.gz	Q38A95_TRYB2 Ubiquitin thioesterase OTU OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1750 PE=4 SV=1
8	AFDB:Q96JH7	0.221	0.068	1.445E-7	1222	0.161	0.046	Q96JH7.pdb.gz	VCIP1_HUMAN Deubiquitinating protein VCPIP1 OS=Homo sapiens OX=9606 GN=VCPIP1 PE=1 SV=2
9	AFDB:F1REJ4	0.227	0.079	3.507E-7	1108	0.129	0.041	F1REJ4.pdb.gz
10	AFDB:Q8LBZ4	0.322	0.350	1.078E-6	317	0.098	0.107	Q8LBZ4.pdb.gz	OTU4_ARATH OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 4 OS=Arabidopsis thaliana OX=3702 GN=OTU4 PE=1 SV=1
11	PDB:4rm8A	0.200	0.190	2.169E-5	368	0.138	0.130	4rm8A.pdb.gz
12	PDB:7rbsB	0.203	0.427	3.281E-5	157	0.057	0.127	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
13	PDB:7w3ax	0.184	0.134	2.598E-4	494	0.095	0.067	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
14	PDB:5itdA	0.180	0.068	3.102E-4	995	0.098	0.034	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
15	PDB:6yvaC	0.197	0.412	4.978E-4	155	0.055	0.123	6yvaC.pdb.gz
16	PDB:5swpA	0.181	0.064	5.944E-4	1060	0.098	0.032	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
17	PDB:3dbhI	0.201	0.700	7.989E-4	86	0.043	0.174	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
18	PDB:5xqmA	0.190	0.607	8.475E-4	90	0.046	0.178	5xqmA.pdb.gz
19	PDB:4pyuA	0.192	0.758	8.991E-4	76	0.043	0.197	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
20	PDB:3ai5A	0.185	0.214	1.074E-3	299	0.043	0.050	3ai5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5VVQ6	0.0	719	348	1.000	1.000	OTU1_HUMAN Ubiquitin thioesterase OTU1 OS=Homo sapiens OX=9606 GN=YOD1 PE=1 SV=1
2	Q9VRJ9	2.66e-82	255	347	0.420	0.421	OTU1_DROME Ubiquitin thioesterase Otu1 OS=Drosophila melanogaster OX=7227 GN=Yod1 PE=2 SV=1
3	Q55BI3	5.21e-63	205	325	0.359	0.385	OTU1_DICDI Ubiquitin thioesterase OTU1 OS=Dictyostelium discoideum OX=44689 GN=yod1 PE=3 SV=1
4	Q9LPT6	1.20e-56	185	208	0.276	0.462	OTU2_ARATH OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 2 OS=Arabidopsis thaliana OX=3702 GN=OTU2 PE=1 SV=1
5	O13974	2.43e-44	157	329	0.290	0.307	OTU1_SCHPO Putative ubiquitin thioesterase otu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=otu1 PE=1 SV=1
6	P43558	3.11e-40	145	301	0.259	0.299	OTU1_YEAST Ubiquitin thioesterase OTU1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OTU1 PE=1 SV=1
7	Q38A95	2.56e-30	118	265	0.244	0.321	Q38A95_TRYB2 Ubiquitin thioesterase OTU OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1750 PE=4 SV=1
8	Q8CF97	2.98e-04	45.1	1221	0.121	0.034	VCIP1_RAT Deubiquitinating protein VCPIP1 OS=Rattus norvegicus OX=10116 GN=Vcpip1 PE=1 SV=2
9	Q8CDG3	3.94e-04	44.7	1220	0.121	0.034	VCIP1_MOUSE Deubiquitinating protein VCPIP1 OS=Mus musculus OX=10090 GN=Vcpip1 PE=1 SV=1
10	Q01804	5.09e-04	44.3	1114	0.092	0.029	OTUD4_HUMAN OTU domain-containing protein 4 OS=Homo sapiens OX=9606 GN=OTUD4 PE=1 SV=4
11	Q96JH7	0.001	43.5	1222	0.118	0.034	VCIP1_HUMAN Deubiquitinating protein VCPIP1 OS=Homo sapiens OX=9606 GN=VCPIP1 PE=1 SV=2
12	Q7L8S5	0.030	38.1	288	0.098	0.118	OTU6A_HUMAN OTU domain-containing protein 6A OS=Homo sapiens OX=9606 GN=OTUD6A PE=1 SV=1
13	B2RRE7	0.079	37.4	1107	0.092	0.029	OTUD4_MOUSE OTU domain-containing protein 4 OS=Mus musculus OX=10090 GN=Otud4 PE=1 SV=1
14	Q9UUK3	0.083	37.0	324	0.066	0.071	OTU2_SCHPO Ubiquitin thioesterase otu2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=otu2 PE=4 SV=1
15	A0A087WTW0	0.13	36.6	857	0.075	0.030	A0A087WTW0_HUMAN E3 ubiquitin-protein ligase UHRF OS=Homo sapiens OX=9606 GN=UHRF1 PE=1 SV=1
16	A0A087WVR3	0.27	35.8	806	0.055	0.024	A0A087WVR3_HUMAN E3 ubiquitin-protein ligase UHRF OS=Homo sapiens OX=9606 GN=UHRF1 PE=1 SV=1
17	Q59W54	0.57	32.3	102	0.069	0.235	Q59W54_CANAL SUMO family protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SMT3 PE=4 SV=1
18	Q8LBZ4	0.94	33.5	317	0.098	0.107	OTU4_ARATH OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 4 OS=Arabidopsis thaliana OX=3702 GN=OTU4 PE=1 SV=1
19	P47057	1.1	33.5	423	0.034	0.028	SNX4_YEAST Sorting nexin-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNX4 PE=1 SV=1
20	Q54W24	1.1	33.9	767	0.052	0.023	ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum OX=44689 GN=abcB4 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02338 OTU	0.018	26.9	OTU-like cysteine protease
2	PF14560 Ubiquitin_2	5.5e+02	12.5	Ubiquitin-like domain
3	PF12756 zf-C2H2_2	1.3e+02	14.3	C2H2 type zinc-finger (2 copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326813

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351777	0.999	Transitional endoplasmic reticulum ATPase
2	9606.ENSP00000441543	0.992	Polyubiquitin-C
3	9606.ENSP00000304697	0.936	Polyubiquitin-B
4	9606.ENSP00000464265	0.936	Ubiquitin B pseudogene 4
5	9606.ENSP00000272317	0.935	Ubiquitin-40S ribosomal protein S27a
6	9606.ENSP00000301281	0.903	UBX domain-containing protein 6
7	9606.ENSP00000263202	0.900	Ubiquitin recognition factor in ER-associated degradation protein 1
8	9606.ENSP00000331487	0.897	Nuclear protein localization protein 4 homolog
9	9606.ENSP00000261942	0.888	FAS-associated factor 2
10	9606.ENSP00000380460	0.877	Phospholipase A-2-activating protein
11	9606.ENSP00000388107	0.877	Ubiquitin-60S ribosomal protein L40
12	9606.ENSP00000339389	0.832	OTU domain-containing protein 6A
13	9606.ENSP00000263966	0.825	Ubiquitin carboxyl-terminal hydrolase 13
14	9606.ENSP00000343526	0.814	Ubiquitin carboxyl-terminal hydrolase 1
15	9606.ENSP00000418529	0.770	NSFL1 cofactor p47
16	9606.ENSP00000290649	0.761	E3 ubiquitin-protein ligase AMFR
17	9606.ENSP00000285420	0.757	[Isoform 1]: Deubiquitinating enzyme that may play a role in the ubiquitin-dependent regulation of protein synthesis, downstream of mTORC1 . May associate with the protein synthesis initiation complex and modify its ubiquitination to repress translation . May also repress DNA synthesis and modify different cellular targets thereby regulating cell growth and proliferation . May also play a role in proteasome assembly and function
18	9606.ENSP00000444357	0.753	Ubiquitin thioesterase OTUB1
19	9606.ENSP00000343001	0.751	Ubiquitin conjugation factor E4 B
20	9606.ENSP00000364261	0.738	OTU domain-containing protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031625	1.000	ubiquitin protein ligase binding
GO:1990380	1.000	K48-linked deubiquitinase activity
GO:0061578	1.000	K63-linked deubiquitinase activity
GO:0004843	1.000	cysteine-type deubiquitinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0050794	0.996	regulation of cellular process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0010498	0.991	proteasomal protein catabolic process
GO:0036211	0.988	protein modification process
GO:0006511	0.988	ubiquitin-dependent protein catabolic process
GO:0036503	0.980	ERAD pathway
GO:0070646	0.976	protein modification by small protein removal
GO:0048519	0.971	negative regulation of biological process
GO:0048523	0.939	negative regulation of cellular process
GO:0016579	0.924	protein deubiquitination
GO:0060341	0.909	regulation of cellular localization
GO:0043161	0.886	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0035966	0.884	response to topologically incorrect protein
GO:0030433	0.873	ubiquitin-dependent ERAD pathway
GO:0032880	0.835	regulation of protein localization
GO:0035967	0.833	cellular response to topologically incorrect protein
GO:0007154	0.753	cell communication
GO:0023052	0.686	signaling
GO:0007165	0.531	signal transduction
GO:0019222	0.425	regulation of metabolic process
GO:0061919	0.407	process utilizing autophagic mechanism
GO:1903828	0.398	negative regulation of protein localization
GO:0032386	0.396	regulation of intracellular transport
GO:0033157	0.392	regulation of intracellular protein transport
GO:0006986	0.385	response to unfolded protein
GO:0032387	0.382	negative regulation of intracellular transport
GO:0030968	0.382	endoplasmic reticulum unfolded protein response
GO:0048518	0.376	positive regulation of biological process
GO:0060255	0.371	regulation of macromolecule metabolic process
GO:1904950	0.371	negative regulation of establishment of protein localization
GO:0051171	0.364	regulation of nitrogen compound metabolic process
GO:0070536	0.361	protein K63-linked deubiquitination
GO:0048522	0.356	positive regulation of cellular process
GO:0051224	0.352	negative regulation of protein transport
GO:0080090	0.339	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0070013	0.943	intracellular organelle lumen
GO:0031981	0.929	nuclear lumen
GO:0005654	0.909	nucleoplasm
GO:0012505	0.315	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]