StarFunc result for job id Q5VVS0

User Input

>input (124 residues)
MTQNSSSLGDRIITPYTPPRSQPMNKHLFVSLSTLFQTTELDFANKKSCFLCLPLRADGF
PEMPHSPAQTERMQKLAKDPPHARSEDVPDHLFFVDTAGLREIVCFCGVLSLRTSEGLMR
KETA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1w4tA	0.186	0.095	1.795	277	0.081	0.036	1w4tA.pdb.gz
2	PDB:3aqdM	0.132	0.243	1.910	60	0.065	0.133	3aqdM.pdb.gz
3	AFDB:Q6P1M9	0.130	0.046	2.251	558	0.073	0.016	Q6P1M9.pdb.gz	ARMX5_HUMAN Armadillo repeat-containing X-linked protein 5 OS=Homo sapiens OX=9606 GN=ARMCX5 PE=1 SV=1
4	PDB:7kgbC	0.178	0.093	2.302	272	0.073	0.033	7kgbC.pdb.gz	Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
5	PDB:2vouA	0.182	0.068	2.449	393	0.040	0.013	2vouA.pdb.gz	Structure of 2,6-Dihydroxypyridine 3-Hydroxylase from a Nicotine-Degrading Pathway.
6	PDB:5uz4Z	0.178	0.081	2.951	323	0.097	0.037	5uz4Z.pdb.gz	The cryo-EM structure of YjeQ bound to the 30S subunit suggests a fidelity checkpoint function for this protein in ribosome assembly.
7	PDB:1t9mA	0.139	0.097	3.555	204	0.065	0.039	1t9mA.pdb.gz	Structure of the phenazine biosynthesis enzyme PhzG.
8	PDB:7mhwA	0.179	0.058	3.555	471	0.032	0.008	7mhwA.pdb.gz
9	PDB:2pfrA	0.179	0.084	4.025	290	0.097	0.041	2pfrA.pdb.gz	The Crystal Structure of Human N-acetyltransferase 2 in complex with CoA
10	AFDB:P15436	0.126	0.020	4.188	1097	0.169	0.019	P15436.pdb.gz	DPOD_YEAST DNA polymerase delta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=POL3 PE=1 SV=4
11	PDB:1wapA	0.141	0.239	4.557	68	0.065	0.118	1wapA.pdb.gz	The structure of trp RNA-binding attenuation protein.
12	PDB:7pntR	0.151	0.070	4.849	294	0.145	0.061	7pntR.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
13	AFDB:Q18624	0.144	0.056	5.713	376	0.161	0.053	Q18624.pdb.gz	Q18624_CAEEL SAND domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gmeb-3 PE=1 SV=2
14	AFDB:Q8SXP0	0.112	0.030	5.713	1089	0.113	0.013	Q8SXP0.pdb.gz	Q8SXP0_DROME phosphatidate phosphatase OS=Drosophila melanogaster OX=7227 GN=Lpin PE=1 SV=1
15	AFDB:P9WJI5	0.194	0.087	6.469	283	0.024	0.011	P9WJI5.pdb.gz	NAT_MYCTU Arylamine N-acetyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nat PE=1 SV=1
16	AFDB:Q8IS18	0.155	0.030	6.469	1037	0.153	0.018	Q8IS18.pdb.gz	GEFE_DICDI Ras guanine nucleotide exchange factor E OS=Dictyostelium discoideum OX=44689 GN=gefE PE=2 SV=1
17	AFDB:P00522	0.170	0.021	7.324	1620	0.153	0.012	P00522.pdb.gz	ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster OX=7227 GN=Abl PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H4B6	1.1	30.8	383	0.234	0.076	SAV1_HUMAN Protein salvador homolog 1 OS=Homo sapiens OX=9606 GN=SAV1 PE=1 SV=2
2	H0YJH0	1.2	30.8	312	0.234	0.093	H0YJH0_HUMAN Salvador family WW domain containing protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=SAV1 PE=1 SV=1
3	Q8VEB2	2.7	29.6	386	0.226	0.073	SAV1_MOUSE Protein salvador homolog 1 OS=Mus musculus OX=10090 GN=Sav1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 653045.Strvi_3052

Rank	PPI partner	STRING score	Description
1	653045.Strvi_7202	0.942	PFAM: Glutamine amidotransferase class-I, C-terminal
2	653045.Strvi_1459	0.928	Catalyzes the condensation of para-aminobenzoate (pABA) with 6-hydroxymethyl-7,8-dihydropterin diphosphate (DHPt-PP) to form 7,8- dihydropteroate (H2Pte), the immediate precursor of folate derivatives.
3	653045.Strvi_8896	0.928	Catalyzes the condensation of para-aminobenzoate (pABA) with 6-hydroxymethyl-7,8-dihydropterin diphosphate (DHPt-PP) to form 7,8- dihydropteroate (H2Pte), the immediate precursor of folate derivatives.
4	653045.Strvi_3026	0.900	Catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the biosynthesis of pyridoxal 5'-phosphate. The resulting ammonia molecule is channeled to the active site of PdxS.
5	653045.Strvi_3053	0.892	Belongs to the shikimate dehydrogenase family.
6	653045.Strvi_3051	0.743	Could be a nuclease involved in processing of the 5'-end of pre-16S rRNA
7	653045.Strvi_3050	0.716	Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged Ser-tRNA(Ala) and Gly-tRNA(Ala) via its editing domain
8	653045.Strvi_3048	0.704	KEGG: sgr:SGR_6032 putative secreted protein
9	653045.Strvi_3054	0.669	Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system
10	653045.Strvi_3055	0.668	Catalyzes the specific phosphorylation of the 3-hydroxyl group of shikimic acid using ATP as a cosubstrate
11	653045.Strvi_3049	0.667	KEGG: sma:SAV_6849 secreted protein
12	653045.Strvi_3845	0.641	PFAM: Glycosyl transferase, family 51
13	653045.Strvi_9005	0.634	PFAM: Glycosyl transferase, family 51
14	653045.Strvi_1350	0.621	PFAM: Glycosyl transferase, family 51
15	653045.Strvi_9213	0.616	PFAM: Glycosyl transferase, family 51
16	653045.Strvi_8252	0.612	PFAM: Glycosyl transferase, family 51
17	653045.Strvi_3079	0.591	Belongs to the class I-like SAM-binding methyltransferase superfamily. RsmB/NOP family
18	653045.Strvi_7163	0.589	Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls the timing and the location of cell division. One of the functions of the FtsZ ring is to recruit other cell division proteins to the septum to produce a new cell wall between the dividing cells. Binds GTP and shows GTPase activity.
19	653045.Strvi_8970	0.572	Phosphorylation of dTMP to form dTDP in both de novo and salvage pathways of dTTP synthesis
20	653045.Strvi_3056	0.568	Catalyzes the conversion of 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) to dehydroquinate (DHQ)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.716	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043226	0.607	organelle
GO:0043227	0.517	membrane-bounded organelle
GO:0043229	0.499	intracellular organelle
GO:0043231	0.484	intracellular membrane-bounded organelle
GO:0005739	0.428	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]