StarFunc result for job id Q5VW22

User Input

>input (663 residues)
MGNILTCRVHPSVSLEFDQQQGSVCPSESETYEAGARDRMAGAPMAAAVQPAEVTVEVGE
DLHMHHVRDREMPEALEFNPSANPEASTIFQRNSQTDVVEIRRSNCTNHVSAVRFSQQYS
LCSTIFLDDSTAIQHYLTMTIISVTLEIPHHITQRDADRTLSIPDEQLHSFAVSTVHIMK
KRNGGGSLNNYSSSIPSTPSTSQEDPQFSVPPTANTPTPVCKRSMRWSNLFTSEKGSDPD
KERKAPENHADTIGSGRAIPIKQGMLLKRSGKWLKTWKKKYVTLCSNGMLTYYSSLGDYM
KNIHKKEIDLQTSTIKVPGKWPSLATSACTPISSSKSNGLSKDMDTGLGDSICFSPSISS
TTSPKLNPPPSPHANKKKHLKKKSTNNFMIVSATGQTWHFEATTYEERDAWVQAIQSQIL
ASLQSCESSKSKSQLTSQSEAMALQSIQNMRGNAHCVDCETQNPKWASLNLGVLMCIECS
GIHRSLGPHLSRVRSLELDDWPVELRKVMSSIVNDLANSIWEGSSQGQTKPSEKSTREEK
ERWIRSKYEEKLFLAPLPCTELSLGQQLLRATADEDLQTAILLLAHGSCEEVNETCGEGD
GCTALHLACRKGNVVLAQLLIWYGVDVMARDAHGNTALTYARQASSQECINVLLQYGCPD
ECV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F8VVT9	0.358	0.204	6.209E-49	1192	0.443	0.247	F8VVT9.pdb.gz	F8VVT9_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
2	PDB:3lvqE	0.251	0.378	3.410E-13	420	0.112	0.176	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
3	PDB:3ljuX	0.177	0.309	1.352E-9	373	0.066	0.118	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
4	PDB:3o47A	0.122	0.270	8.249E-6	289	0.050	0.114	3o47A.pdb.gz	Crystal structure of ARFGAP1-ARF1 fusion protein
5	PDB:8cs9A	0.135	0.113	1.869E-4	796	0.044	0.036	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
6	PDB:6v9hC	0.132	0.317	5.195E-4	270	0.039	0.096	6v9hC.pdb.gz
7	PDB:6bbpA	0.127	0.161	5.482E-4	520	0.047	0.060	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
8	PDB:4oauC	0.140	0.134	1.444E-3	692	0.044	0.042	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
9	PDB:6jd6B	0.130	0.439	1.444E-3	192	0.036	0.125	6jd6B.pdb.gz
10	PDB:6hhgA	0.126	0.210	1.697E-3	386	0.039	0.067	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
11	AFDB:Q5H9F3	0.123	0.049	1.934E-3	1711	0.148	0.057	Q5H9F3.pdb.gz	BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens OX=9606 GN=BCORL1 PE=1 SV=2
12	PDB:1bd8A	0.087	0.246	2.473E-3	156	0.044	0.186	1bd8A.pdb.gz
13	AFDB:P34288	0.132	0.059	3.496E-3	1605	0.101	0.042	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
14	AFDB:Q6W2J9	0.126	0.052	9.717E-3	1755	0.128	0.048	Q6W2J9.pdb.gz	BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1
15	AFDB:A0A0G2K889	0.113	0.065	1.205E-2	1289	0.158	0.081	A0A0G2K889.pdb.gz	A0A0G2K889_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=2
16	AFDB:Q13009	0.173	0.085	1.342E-2	1591	0.137	0.057	Q13009.pdb.gz	TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 OS=Homo sapiens OX=9606 GN=TIAM1 PE=1 SV=2
17	AFDB:F1RCL8	0.134	0.052	1.664E-2	1796	0.146	0.054	F1RCL8.pdb.gz	F1RCL8_DANRE BCL-6 corepressor isoform X1 OS=Danio rerio OX=7955 GN=bcor PE=1 SV=1
18	AFDB:A2ABF9	0.152	0.090	2.559E-2	1267	0.163	0.085	A2ABF9.pdb.gz	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
19	AFDB:Q8CGN4	0.131	0.051	2.701E-2	1759	0.134	0.051	Q8CGN4.pdb.gz	BCOR_MOUSE BCL-6 corepressor OS=Mus musculus OX=10090 GN=Bcor PE=1 SV=2
20	AFDB:Q8WZ74	0.146	0.060	5.736E-2	1663	0.151	0.060	Q8WZ74.pdb.gz	CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens OX=9606 GN=CTTNBP2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UPQ3	0.0	554	857	0.422	0.327	AGAP1_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AGAP1 PE=1 SV=4
2	U6A022	0.0	573	808	0.434	0.356	U6A022_RAT ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 OS=Rattus norvegicus OX=10116 GN=Agap3 PE=2 SV=1
3	J3KNM6	1.59e-148	459	1036	0.370	0.236	J3KNM6_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 (Fragment) OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
4	F8VVT9	6.34e-144	451	1192	0.373	0.207	F8VVT9_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
5	Q99490	9.26e-144	450	1192	0.373	0.207	AGAP2_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=2
6	Q3UHD9	6.44e-138	435	1186	0.376	0.210	AGAP2_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Agap2 PE=1 SV=1
7	Q8CGU4	7.01e-138	435	1186	0.376	0.210	AGAP2_RAT Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Agap2 PE=1 SV=1
8	Q8VHH5	1.11e-134	419	910	0.297	0.216	AGAP3_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Agap3 PE=1 SV=1
9	A0JMI1	9.09e-133	412	827	0.373	0.299	A0JMI1_DANRE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Danio rerio OX=7955 GN=agap2 PE=2 SV=1
10	Q9XX14	9.04e-83	285	1107	0.279	0.167	CNT2_CAEEL Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 OS=Caenorhabditis elegans OX=6239 GN=cnt-2 PE=1 SV=2
11	Q9NGC3	1.94e-74	260	995	0.210	0.140	CEG1A_DROME Centaurin-gamma-1A OS=Drosophila melanogaster OX=7227 GN=CenG1A PE=2 SV=2
12	Q54WI0	1.91e-38	155	1333	0.178	0.089	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1
13	Q4QQN0	1.98e-34	141	626	0.122	0.129	Q4QQN0_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
14	A2ADA6	3.52e-34	141	829	0.122	0.098	A2ADA6_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
15	Q3UH98	3.78e-34	141	833	0.122	0.097	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
16	Q6NXL5	4.17e-34	141	833	0.122	0.097	Q6NXL5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
17	Q8N7R7	3.42e-32	130	359	0.127	0.234	CCYL1_HUMAN Cyclin-Y-like protein 1 OS=Homo sapiens OX=9606 GN=CCNYL1 PE=1 SV=2
18	Q8MSZ5	1.46e-31	125	235	0.116	0.328	Q8MSZ5_DROME GM06875p OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=2 SV=1
19	Q9DE64	1.54e-31	133	757	0.124	0.108	Q9DE64_CHICK p95-APP2 OS=Gallus gallus OX=9031 GN=p95-APP2 PE=2 SV=1
20	Q15057	2.68e-31	132	778	0.115	0.098	ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	3.2e-06	38.5	Ankyrin repeat
2	PF12796 Ank_2	2.1e-06	39.6	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.1	20.9	Ankyrin repeat
4	PF13637 Ank_4	0.011	27.5	Ankyrin repeats (many copies)
5	PF13857 Ank_5	3.5e-05	35.3	Ankyrin repeats (many copies)
6	PF01412 ArfGap	1.2e-33	127.1	Putative GTPase activating protein for Arf
7	PF00169 PH	5.4e-07	41.4	PH domain
8	PF15413 PH_11	0.38	22.6	Pleckstrin homology domain
9	PF20399 PH_20	3.8e+02	12.6	PH domain
10	PF15404 PH_4	57	15.0	Pleckstrin homology domain
11	PF15406 PH_6	8.5	18.1	Pleckstrin homology domain
12	PF15409 PH_8	3.9	19.1	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000400972

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363123	0.604	AT-hook DNA-binding motif-containing protein 1
2	9606.ENSP00000288065	0.567	Armadillo repeat containing 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0008289	0.982	lipid binding
GO:0005543	0.974	phospholipid binding
GO:0098772	0.862	molecular function regulator activity
GO:0030695	0.670	GTPase regulator activity
GO:0003824	0.418	catalytic activity
GO:0140677	0.417	molecular function activator activity
GO:0097159	0.391	organic cyclic compound binding
GO:0043168	0.391	anion binding
GO:1901363	0.384	heterocyclic compound binding
GO:1901981	0.363	phosphatidylinositol phosphate binding
GO:0005096	0.359	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.910	cellular process
GO:0032502	0.882	developmental process
GO:0048856	0.855	anatomical structure development
GO:0065007	0.750	biological regulation
GO:0050789	0.434	regulation of biological process
GO:0050794	0.401	regulation of cellular process
GO:0032501	0.300	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0005634	0.984	nucleus
GO:0016020	0.851	membrane
GO:0071944	0.823	cell periphery
GO:0005829	0.407	cytosol
GO:0070013	0.393	intracellular organelle lumen
GO:0031981	0.379	nuclear lumen
GO:0012505	0.358	endomembrane system
GO:0005654	0.310	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]