StarFunc result for job id Q5VW36

User Input

>input (1801 residues)
MSDDIRKRFEFPNSLIQSQAVGHLIAAVLKENGFSEKIHQSTNQTPALNLLWEKCCSDNV
VVRTACCEGLVALVAQDHAEFSYVLNGILNLIPSTRNTHGLIKAIMHLLQMQALKEGQGG
EKNIQSIYTIRNHPHPLITVLEHRPDCWPVFLQQLTAFFQQCPERLEVSCIQIMAPFLWY
LYCEPSQLQEYAKLRLALLKVLLQPQVLCDKDQPSILEQQILQLCCDIVPCLQVKDLIQT
TEAMMFIEEVCLSLLRHPVFWKIQLTQMSLQLLCVSEVSLKITGECSSSIHLLEHSVELL
KEDFPVELVIIGIALLLLQTPASQQKPILNLALKLLSVTEDQKIPKSSLLLVMPILQILS
STALEDCISVDEEGPSRQQLALNLLEMIQQECYRDDHQKLSYKLVCPVTSMYGTIFTAWR
ILEVMTDSSAASDWLASVESLLPITAVIPAPAFLLLAHLLVEDKGQNLHQILKVTTELAQ
ADSSQVPNLIPVLMFKLGRPLEPILYNDILYTLPKLGVHKVCIGQILRIIQLLGTTPRLR
AVTLRLLTSLWEKQDRVYPELQRFMAVSDVPSLSVGKEVQWEKLIAKAASIRDICKQRPY
QHGADMLAAISQVLNECTKPDQATPAALVLQGLHALCQAEVVCIRSTWNALSPKLSCDTR
PLILKTLSELFSLVPSLTVNTTEYENFKVQVLSFLWTHTQNKDPIVANAAYRSLANFTAG
EHTILHLPEKIRPEIPIPEELDDDEDVEDVDLSVPGSCYLKLLSLTPPLVLPALEEFFTS
LVKQEMVNMPRGIYHSALKGGARSDQGKTVAGIPNFILKMYETNKQPGLKPGLAGGMLFC
YDVSMYQSKDGKPLNRLMASRGRSFKQTSLALVHEVHIQLSEWHRAIFLPQAWLAYMNRA
YHAILQGRLGELELQLKHGKEEPEEVQYKKSTAWLWVRDMLTDEITKAAAKESPVVKGNA
LLALSSLAVVVSRHEASLSSDSDGLLEVQPNFLSMKEWVSMVLDTLLVIVDSHYQPRGQL
LSWFYYKSYSGENTASAIARSAAATALSLLVPVFIISCKEKVEEILNMLTARLPGKPSAD
ESQAVQIHMGLALGMFLSRLCEEKLSDISGQEMNLLLMKSLDALENCCFDTSLEYNTGCI
LGVGLVLSLMSHSSQMQSRVHVAALLRKLSAHVDDSGSQSRTFQEVLAYTLSCVCTSAFS
AGIIEATEAEDVMNKLRLLVENSQQTSGFALALGNIVHGLSVCGHGKAEDLGSKLLPAWI
RIVLTEGTPTMLCLAALHGMVALVGSEGDVMQLKSEAIQTSHFQGRLNEVIRTLTQVISV
SGVIGLQSNAVWLLGHLHLSTLSSSQSRASVPTDYSYLPESSFIGAAIGFFITGGKKGPE
SVPPSLLKVVMKPIATVGESYQYPPVNWAALLSPLMRLNFGEEIQQLCLEIMVTQAQSSQ
NAAALLGLWVTPPLIHSLSLNTKRYLLISAPLWIKHISDEQILGFVENLMVAVFKAASPL
GSPELCPSALHGLSQAMKLPSPAHHLWSLLSEATGKIFDLLPNKIRRKDLELYISIAKCL
LEMTDDDANRIAQVTKSNIEKAAFVKLYLVSQGRFPLVNLTDMLSVAVQHREKEVLAWMI
LHSLYQARIVSHANTGVLKRMEWLLELMGYIRNVAYQSTSFHNTALDKALDFFLLIFATA
VVAWADHTAPLLLGLSASWLPWHQENGPAGPVPSFLGRSPMHRVTLQEVLTLLPNSMALL
LQKEPWKEQTQKFIDWLFSIMESPKEALSAQSRDLLKATLLSLRVLPEFKKKAVWTRAYG
W

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VW36	1.000	1.000	0.000	1801	1.000	1.000	Q5VW36.pdb.gz	FOCAD_HUMAN Focadhesin OS=Homo sapiens OX=9606 GN=FOCAD PE=1 SV=2
2	AFDB:Q7XZF5	0.541	0.532	1.467E-32	1841	0.172	0.168	Q7XZF5.pdb.gz	RST1_ARATH Protein RST1 OS=Arabidopsis thaliana OX=3702 GN=RST1 PE=1 SV=2
3	AFDB:Q54C50	0.272	0.246	1.420E-27	2043	0.167	0.147	Q54C50.pdb.gz	Q54C50_DICDI Armadillo-like helical domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DG1098 PE=4 SV=1
4	AFDB:Q5VYK3	0.119	0.117	7.548E-11	1845	0.129	0.126	Q5VYK3.pdb.gz	ECM29_HUMAN Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2
5	AFDB:F4I718	0.132	0.117	1.234E-10	2136	0.153	0.129	F4I718.pdb.gz	CSI3_ARATH Protein CELLULOSE SYNTHASE INTERACTIVE 3 OS=Arabidopsis thaliana OX=3702 GN=CSI3 PE=1 SV=1
6	AFDB:F4IIM1	0.169	0.149	1.880E-10	2150	0.141	0.118	F4IIM1.pdb.gz	CSI1_ARATH Protein CELLULOSE SYNTHASE INTERACTIVE 1 OS=Arabidopsis thaliana OX=3702 GN=CSI1 PE=1 SV=1
7	AFDB:F4IP13	0.130	0.134	2.241E-10	1716	0.122	0.128	F4IP13.pdb.gz	SHGR6_ARATH Protein SHOOT GRAVITROPISM 6 OS=Arabidopsis thaliana OX=3702 GN=SGR6 PE=2 SV=1
8	AFDB:Q9P3A8	0.133	0.175	2.579E-10	1220	0.107	0.157	Q9P3A8.pdb.gz	CAND1_SCHPO Cullin-associated NEDD8-dissociated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=knd1 PE=3 SV=1
9	AFDB:O14356	0.110	0.092	3.664E-10	2335	0.135	0.104	O14356.pdb.gz	TOR1_SCHPO Serine/threonine-protein kinase tor1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tor1 PE=1 SV=1
10	AFDB:A0A1D8PHX3	0.114	0.089	4.070E-10	2482	0.133	0.097	A0A1D8PHX3.pdb.gz	A0A1D8PHX3_CANAL Serine/threonine-protein kinase TOR OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TOR1 PE=3 SV=1
11	PDB:7su3A	0.120	0.074	2.076E-9	3802	0.150	0.071	7su3A.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
12	PDB:6zwmB	0.136	0.115	2.150E-9	2185	0.135	0.112	6zwmB.pdb.gz	The 3.2- angstrom resolution structure of human mTORC2.
13	PDB:7sukSP	0.111	0.092	4.045E-9	2234	0.147	0.119	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
14	PDB:7mqaLM	0.114	0.107	4.655E-9	2041	0.128	0.113	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7ajuUT	0.131	0.106	4.821E-9	2313	0.140	0.109	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:7mopA	0.100	0.082	6.849E-9	2445	0.134	0.099	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
17	PDB:6x9oA	0.096	0.082	8.163E-9	2425	0.152	0.113	6x9oA.pdb.gz
18	PDB:7mq8LM	0.126	0.116	8.454E-9	2005	0.135	0.121	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7mq8SP	0.112	0.104	1.590E-8	1993	0.138	0.124	7mq8SP.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:7otmA	0.123	0.083	1.647E-8	3656	0.132	0.065	7otmA.pdb.gz	Structural insights into inhibitor regulation of the DNA repair protein DNA-PKcs.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5VW36	0.0	3682	1801	0.999	0.999	FOCAD_HUMAN Focadhesin OS=Homo sapiens OX=9606 GN=FOCAD PE=1 SV=2
2	Q7XZF5	6.86e-05	50.4	1841	0.018	0.017	RST1_ARATH Protein RST1 OS=Arabidopsis thaliana OX=3702 GN=RST1 PE=1 SV=2
3	Q54C50	2.74e-04	48.5	2043	0.026	0.023	Q54C50_DICDI Armadillo-like helical domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DG1098 PE=4 SV=1
4	Q86L18	0.15	39.3	535	0.011	0.036	Q86L18_DICDI Carboxylic ester hydrolase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276969 PE=3 SV=1
5	P18142	0.69	37.0	535	0.011	0.036	D2_DICDI cAMP-regulated D2 protein OS=Dictyostelium discoideum OX=44689 GN=D2 PE=2 SV=3
6	P16297	1.8	35.8	539	0.013	0.045	IL2RB_MOUSE Interleukin-2 receptor subunit beta OS=Mus musculus OX=10090 GN=Il2rb PE=1 SV=1
7	P9WPS7	2.3	35.4	771	0.029	0.067	CTPG_MYCTU Probable cation-transporting ATPase G OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ctpG PE=1 SV=1
8	Q5AI14	2.9	35.0	888	0.012	0.024	Q5AI14_CANAL Trehalose-phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TPS2 PE=1 SV=1
9	P9WN03	5.9	34.3	643	0.011	0.031	AFTA_MYCTU Galactan 5-O-arabinofuranosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=aftA PE=1 SV=1
10	P54293	7.0	33.1	249	0.013	0.096	ESAR_PANSE Transcriptional activator protein EsaR OS=Pantoea stewartii subsp. stewartii OX=66271 GN=esaR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12530 DUF3730	9.3e-67	236.5	Focadhesin/RST1, DUF3730
2	PF11229 Focadhesin	0	1018.0	Focadhesin
3	PF02985 HEAT	1.8e+02	13.8	HEAT repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369599

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306822	0.566	Cell death regulator Aven
2	9606.ENSP00000323795	0.536	Testis-expressed protein 35
3	9606.ENSP00000364543	0.527	Helicase SKI2W
4	9606.ENSP00000419503	0.522	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.969	cellular process
GO:0065007	0.887	biological regulation
GO:0050789	0.884	regulation of biological process
GO:0050794	0.858	regulation of cellular process
GO:0044237	0.573	cellular metabolic process
GO:0071704	0.570	organic substance metabolic process
GO:0044238	0.504	primary metabolic process
GO:0006807	0.416	nitrogen compound metabolic process
GO:0050896	0.324	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005925	0.997	focal adhesion
GO:0005737	0.976	cytoplasm
GO:0043226	0.966	organelle
GO:0043229	0.959	intracellular organelle
GO:0043231	0.869	intracellular membrane-bounded organelle
GO:0005829	0.528	cytosol
GO:0005634	0.506	nucleus
GO:0016020	0.494	membrane
GO:0043232	0.413	intracellular non-membrane-bounded organelle
GO:0005654	0.364	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]