StarFunc result for job id Q5VWG9

User Input

>input (929 residues)
MCESYSRSLLRVSVAQICQALGWDSVQLSACHLLTDVLQRYLQQLGRGCHRYSELYGRTD
PILDDVGEAFQLMGVSLHELEDYIHNIEPVTFPHQIPSFPVSKNNVLQFPQPGSKDAEER
KEYIPDYLPPIVSSQEEEEEEQVPTDGGTSAEAMQVPLEEDDELEEEEIINDENFLGKRP
LDSPEAEELPAMKRPRLLSTKGDTLDVVLLEAREPLSSINTQKIPPMLSPVHVQDSTDLA
PPSPEPPMLAPVAKSQMPTAKPLETKSFTPKTKTKTSSPGQKTKSPKTAQSPAMVGSPIR
SPKTVSKEKKSPGRSKSPKSPKSPKVTTHIPQTPVRPETPNRTPSATLSEKISKETIQVK
QIQTPPDAGKLNSENQPKKAVVADKTIEASIDAVIARACAEREPDPFEFSSGSESEGDIF
TSPKRISGPECTTPKASTSANNFTKSGSTPLPLSGGTSSSDNSWTMDASIDEVVRKAKLG
TPSNMPPNFPYISSPSVSPPTPEPLHKVYEEKTKLPSSVEVKKKLKKELKTKMKKKEKQR
DREREKDKNKDKSKEKDKVKEKEKDKETGRETKYPWKEFLKEEEADPYKFKIKEFEDVDP
KVKLKDGLVRKEKEKHKDKKKDREKGKKDKDKREKEKVKDKGREDKMKAPAPPLVLPPKE
LALPLFSPATASRVPAMLPSLLPVLPEKLFEEKEKVKEKEKKKDKKEKKKKKEKEKEKKE
KEREKEKREREKREKEKEKHKHEKIKVEPVALAPSPVIPRLTLRVGAGQDKIVISKVVPA
PEAKPAPSQNRPKTPPPAPAPAPGPMLVSPAPVPLPLLAQAAAGPALLPSPGPAASGASA
KAPVRSVVTETVSTYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTA
PPEEMQWFCPKCANKKKDKKHKKRKHRAH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VWG9	1.000	1.000	0.000	929	1.000	1.000	Q5VWG9.pdb.gz	TAF3_HUMAN Transcription initiation factor TFIID subunit 3 OS=Homo sapiens OX=9606 GN=TAF3 PE=1 SV=1
2	AFDB:Q5HZG4	0.232	0.232	2.664E-101	932	0.835	0.833	Q5HZG4.pdb.gz	TAF3_MOUSE Transcription initiation factor TFIID subunit 3 OS=Mus musculus OX=10090 GN=Taf3 PE=1 SV=2
3	AFDB:Q5RH27	0.206	0.211	2.763E-57	898	0.497	0.514	Q5RH27.pdb.gz	Q5RH27_DANRE TAF3 RNA polymerase II, TATA box-binding protein (TBP)-associated facto OS=Danio rerio OX=7955 GN=fi76b06 PE=4 SV=2
4	PDB:7edxc	0.127	0.838	2.944E-18	127	0.137	1.000	7edxc.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
5	AFDB:Q9V4D4	0.137	0.100	7.463E-14	1406	0.249	0.164	Q9V4D4.pdb.gz	Q9V4D4_DROME Bip2 OS=Drosophila melanogaster OX=7227 GN=Taf3 PE=1 SV=1
6	PDB:7edxH	0.106	0.430	1.109E-5	209	0.036	0.158	7edxH.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
7	PDB:6mzcK	0.117	0.471	6.667E-5	202	0.029	0.134	6mzcK.pdb.gz
8	AFDB:E9PYF4	0.064	0.040	3.381E-3	1699	0.154	0.084	E9PYF4.pdb.gz	E9PYF4_MOUSE LIM domain only 7 OS=Mus musculus OX=10090 GN=Lmo7 PE=1 SV=1
9	AFDB:F4I420	0.059	0.044	8.290E-3	1294	0.119	0.086	F4I420.pdb.gz	F4I420_ARATH Eukaryotic translation initiation factor 5B OS=Arabidopsis thaliana OX=3702 GN=EIF5B1 PE=1 SV=1
10	AFDB:Q9V9W8	0.067	0.076	9.424E-3	815	0.132	0.151	Q9V9W8.pdb.gz	PYGO_DROME Protein pygopus OS=Drosophila melanogaster OX=7227 GN=pygo PE=1 SV=1
11	AFDB:Q54RP6	0.034	0.023	1.071E-2	1709	0.065	0.035	Q54RP6.pdb.gz	DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum OX=44689 GN=dhkL PE=3 SV=1
12	PDB:7egdF	0.073	0.160	1.121E-2	412	0.024	0.053	7egdF.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
13	AFDB:F6NN15	0.056	0.044	1.573E-2	1384	0.131	0.088	F6NN15.pdb.gz	F6NN15_DANRE LIM domain 7b OS=Danio rerio OX=7955 GN=DKEY-180K21.1 PE=4 SV=2
14	AFDB:P49791	0.042	0.029	2.033E-2	1468	0.146	0.093	P49791.pdb.gz	NU153_RAT Nuclear pore complex protein Nup153 OS=Rattus norvegicus OX=10116 GN=Nup153 PE=1 SV=1
15	PDB:6mzcI	0.063	0.169	2.269E-2	339	0.015	0.041	6mzcI.pdb.gz
16	PDB:7r5sS	0.080	0.534	2.932E-2	120	0.013	0.100	7r5sS.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
17	PDB:1b67A	0.067	0.813	3.126E-2	68	0.012	0.162	1b67A.pdb.gz
18	PDB:3v9rA	0.081	0.773	3.332E-2	88	0.010	0.102	3v9rA.pdb.gz
19	PDB:5y27A	0.072	0.598	3.553E-2	98	0.015	0.143	5y27A.pdb.gz
20	PDB:5z8lA	0.046	0.195	3.788E-2	204	0.016	0.074	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5HZG4	0.0	1263	932	0.834	0.832	TAF3_MOUSE Transcription initiation factor TFIID subunit 3 OS=Mus musculus OX=10090 GN=Taf3 PE=1 SV=2
2	Q5VWG9	0.0	1856	929	1.000	1.000	TAF3_HUMAN Transcription initiation factor TFIID subunit 3 OS=Homo sapiens OX=9606 GN=TAF3 PE=1 SV=1
3	Q5RH27	2.69e-75	267	898	0.233	0.241	Q5RH27_DANRE TAF3 RNA polymerase II, TATA box-binding protein (TBP)-associated facto OS=Danio rerio OX=7955 GN=fi76b06 PE=4 SV=2
4	Q8MSB9	6.54e-24	107	370	0.060	0.151	Q8MSB9_DROME LD24176p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Taf3 PE=2 SV=1
5	Q9V4D4	3.08e-23	109	1406	0.056	0.037	Q9V4D4_DROME Bip2 OS=Drosophila melanogaster OX=7227 GN=Taf3 PE=1 SV=1
6	Q9XZU7	8.66e-23	107	1408	0.055	0.036	Q9XZU7_DROME Bip2 protein OS=Drosophila melanogaster OX=7227 GN=Taf3 PE=2 SV=1
7	Q9U1I0	1.35e-22	107	1406	0.055	0.036	Q9U1I0_DROME BIP2 protein OS=Drosophila melanogaster OX=7227 GN=Taf3 PE=4 SV=1
8	Q8T9I5	1.15e-21	100	363	0.043	0.110	Q8T9I5_DROME GM10839p OS=Drosophila melanogaster OX=7227 GN=Taf3 PE=2 SV=1
9	O74508	1.52e-10	66.6	424	0.031	0.068	SPP1_SCHPO Set1 complex component spp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spp1 PE=4 SV=1
10	A0A0B4K6G3	1.33e-08	61.6	2018	0.025	0.011	A0A0B4K6G3_DROME Protein partner of snf, isoform B OS=Drosophila melanogaster OX=7227 GN=pps PE=1 SV=1
11	Q9VG78	1.41e-08	61.6	2016	0.025	0.011	Q9VG78_DROME Protein partner of snf, isoform A OS=Drosophila melanogaster OX=7227 GN=pps PE=1 SV=1
12	Q5AHB8	1.18e-07	56.6	298	0.023	0.070	YNG2_CANAL Chromatin modification-related protein YNG2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YNG2 PE=3 SV=2
13	Q9VWY6	2.12e-07	56.2	328	0.041	0.116	TAF8_DROME Transcription initiation factor TFIID subunit 8 OS=Drosophila melanogaster OX=7227 GN=Taf8 PE=1 SV=1
14	A0A0B4LGV3	1.12e-06	55.5	2151	0.036	0.015	A0A0B4LGV3_DROME Misexpression suppressor of ras 4, isoform D OS=Drosophila melanogaster OX=7227 GN=MESR4 PE=1 SV=1
15	A0A0B4LFV9	1.16e-06	55.5	2169	0.036	0.015	A0A0B4LFV9_DROME Misexpression suppressor of ras 4, isoform C OS=Drosophila melanogaster OX=7227 GN=MESR4 PE=1 SV=1
16	A1ZAV3	1.16e-06	55.5	2171	0.036	0.015	A1ZAV3_DROME Misexpression suppressor of ras 4, isoform A OS=Drosophila melanogaster OX=7227 GN=MESR4 PE=1 SV=1
17	F1QBY1	1.36e-06	55.1	2876	0.080	0.026	NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio OX=7955 GN=nipblb PE=2 SV=1
18	Q9NXR8	2.01e-06	53.5	418	0.025	0.055	ING3_HUMAN Inhibitor of growth protein 3 OS=Homo sapiens OX=9606 GN=ING3 PE=1 SV=2
19	E7ET07	2.17e-06	53.5	403	0.025	0.057	E7ET07_HUMAN Inhibitor of growth protein OS=Homo sapiens OX=9606 GN=ING3 PE=1 SV=1
20	Q8C0D7	2.23e-06	52.4	249	0.025	0.092	ING4_MOUSE Inhibitor of growth protein 4 OS=Mus musculus OX=10090 GN=Ing4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07524 Bromo_TP	1.5e-14	65.1	Bromodomain associated
2	PF00628 PHD	3.5e-07	41.3	PHD-finger
3	PF13831 PHD_2	52	14.7	PHD-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340271

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252996	0.999	Transcription initiation factor TFIID subunit 4
2	9606.ENSP00000299424	0.999	Transcription initiation factor TFIID subunit 10
3	9606.ENSP00000312709	0.999	Transcription initiation factor TFIID subunit 7
4	9606.ENSP00000354633	0.999	Transcription initiation factor TFIID subunit 11
5	9606.ENSP00000355051	0.999	Transcription initiation factor TFIID subunit 13
6	9606.ENSP00000367406	0.999	Transcription initiation factor TFIID subunit 2
7	9606.ENSP00000375942	0.999	TATA-box-binding protein
8	9606.ENSP00000399982	0.999	Transcription initiation factor TFIID subunit 6
9	9606.ENSP00000406549	0.999	Transcription initiation factor TFIID subunit 1
10	9606.ENSP00000247219	0.998	TATA box-binding protein-like protein 2
11	9606.ENSP00000263974	0.998	Transcription initiation factor TFIID subunit 12
12	9606.ENSP00000359531	0.998	Transcription initiation factor IIB
13	9606.ENSP00000358854	0.997	Transcription initiation factor TFIID subunit 5
14	9606.ENSP00000377969	0.994	General transcription factor IIF subunit 1
15	9606.ENSP00000370193	0.993	Transcription initiation factor TFIID subunit 9
16	9606.ENSP00000339917	0.982	Transcription initiation factor TFIID subunit 9B
17	9606.ENSP00000418379	0.981	Transcription initiation factor TFIID subunit 1-like
18	9606.ENSP00000362068	0.974	Transcription initiation factor TFIID subunit 8
19	9606.ENSP00000361998	0.972	Transcription initiation factor TFIID subunit 7-like
20	9606.ENSP00000348168	0.952	Transcription initiation factor IIE subunit beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016251	1.000	RNA polymerase II general transcription initiation factor activity
GO:0005515	1.000	protein binding
GO:0008134	0.502	transcription factor binding
GO:1901363	0.371	heterocyclic compound binding
GO:0097159	0.371	organic cyclic compound binding
GO:0003676	0.351	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0006807	0.993	nitrogen compound metabolic process
GO:0043170	0.992	macromolecule metabolic process
GO:0044237	0.991	cellular metabolic process
GO:0051252	0.991	regulation of RNA metabolic process
GO:0010468	0.988	regulation of gene expression
GO:0010556	0.985	regulation of macromolecule biosynthetic process
GO:0031326	0.985	regulation of cellular biosynthetic process
GO:0006366	0.983	transcription by RNA polymerase II
GO:0048519	0.980	negative regulation of biological process
GO:0006355	0.980	regulation of DNA-templated transcription
GO:0006357	0.966	regulation of transcription by RNA polymerase II
GO:0048523	0.964	negative regulation of cellular process
GO:0010605	0.950	negative regulation of macromolecule metabolic process
GO:0048522	0.940	positive regulation of cellular process
GO:0031324	0.923	negative regulation of cellular metabolic process
GO:0051172	0.920	negative regulation of nitrogen compound metabolic process
GO:0000122	0.910	negative regulation of transcription by RNA polymerase II
GO:0009893	0.904	positive regulation of metabolic process
GO:0036211	0.879	protein modification process
GO:0010604	0.875	positive regulation of macromolecule metabolic process
GO:0045935	0.873	positive regulation of nucleobase-containing compound metabolic process
GO:0065009	0.859	regulation of molecular function
GO:0045893	0.856	positive regulation of DNA-templated transcription
GO:0071840	0.827	cellular component organization or biogenesis
GO:0016043	0.814	cellular component organization
GO:0051090	0.810	regulation of DNA-binding transcription factor activity
GO:0044092	0.798	negative regulation of molecular function
GO:0043433	0.793	negative regulation of DNA-binding transcription factor activity
GO:0045944	0.755	positive regulation of transcription by RNA polymerase II
GO:0006352	0.535	DNA-templated transcription initiation
GO:0006367	0.350	transcription initiation at RNA polymerase II promoter
GO:0065004	0.340	protein-DNA complex assembly
GO:2000142	0.306	regulation of DNA-templated transcription initiation
GO:0060260	0.304	regulation of transcription initiation by RNA polymerase II
GO:2000144	0.303	positive regulation of DNA-templated transcription initiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0140513	0.992	nuclear protein-containing complex
GO:0012505	0.947	endomembrane system
GO:0140535	0.946	intracellular protein-containing complex
GO:1902494	0.944	catalytic complex
GO:0016020	0.942	membrane
GO:1990234	0.930	transferase complex
GO:0043232	0.915	intracellular non-membrane-bounded organelle
GO:0005667	0.912	transcription regulator complex
GO:0016591	0.908	RNA polymerase II, holoenzyme
GO:0090575	0.883	RNA polymerase II transcription regulator complex
GO:0005737	0.769	cytoplasm
GO:0005669	0.723	transcription factor TFIID complex
GO:0031090	0.674	organelle membrane
GO:0031975	0.559	envelope
GO:0031967	0.473	organelle envelope
GO:0005635	0.418	nuclear envelope
GO:0031965	0.380	nuclear membrane
GO:0000785	0.361	chromatin
GO:0005829	0.313	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]