StarFunc result for job id Q5VWK5

User Input

>input (629 residues)
MNQVTIQWDAVIALYILFSWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQ
PRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDIS
SGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYIN
ISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAVISRAETINATVPKTII
YWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETG
KRYWQPWSSLFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDNRGDIGLLLGM
IVFAVMLSILSLIGIFNRSFRTGIKRRILLLIPKWLYEDIPNMKNSNVVKMLQENSELMN
NNSSEQVLYVDPMITEIKEIFIPEHKPTDYKKENTGPLETRDYPQNSLFDNTTVVYIPDL
NTGYKPQISNFLPEGSHLSNNNEITSLTLKPPVDSLDSGNNPRLQKHPNFAFSVSSVNSL
SNTIFLGELSLILNQGECSSPDIQNSVEEETTMLLENDSPSETIPEQTLLPDEFVSCLGI
VNEELPSINTYFPQNILESHFNRISLLEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VWK5	1.000	1.000	4.349E-104	629	1.000	1.000	Q5VWK5.pdb.gz	IL23R_HUMAN Interleukin-23 receptor OS=Homo sapiens OX=9606 GN=IL23R PE=1 SV=3
2	AFDB:Q8K4B4	0.643	0.629	1.478E-75	644	0.685	0.669	Q8K4B4.pdb.gz	IL23R_MOUSE Interleukin-23 receptor OS=Mus musculus OX=10090 GN=Il23r PE=2 SV=1
3	AFDB:Q2Q0I9	0.170	0.075	2.522E-16	1779	0.113	0.040	Q2Q0I9.pdb.gz	FNDC1_RAT Fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Fndc1 PE=1 SV=2
4	AFDB:Q2EY15	0.162	0.096	3.103E-16	1191	0.121	0.064	Q2EY15.pdb.gz	PRTG_MOUSE Protogenin OS=Mus musculus OX=10090 GN=Prtg PE=2 SV=1
5	AFDB:Q92859	0.144	0.068	4.947E-16	1461	0.132	0.057	Q92859.pdb.gz	NEO1_HUMAN Neogenin OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=2
6	AFDB:A0A2R8QL08	0.169	0.067	1.257E-15	2036	0.130	0.040	A0A2R8QL08.pdb.gz
7	AFDB:Q1L8D0	0.144	0.092	2.341E-15	1125	0.134	0.075	Q1L8D0.pdb.gz	Q1L8D0_DANRE Cell adhesion molecule-related/down-regulated by oncogenes OS=Danio rerio OX=7955 GN=zgc:158240 PE=2 SV=2
8	AFDB:Q8C310	0.151	0.101	1.640E-13	1012	0.134	0.083	Q8C310.pdb.gz	ROBO4_MOUSE Roundabout homolog 4 OS=Mus musculus OX=10090 GN=Robo4 PE=1 SV=2
9	AFDB:F1R2D2	0.154	0.066	1.819E-13	1687	0.107	0.040	F1R2D2.pdb.gz
10	AFDB:F1RE66	0.140	0.085	7.993E-12	1134	0.134	0.074	F1RE66.pdb.gz	F1RE66_DANRE Roundabout homolog 4 isoform X1 OS=Danio rerio OX=7955 GN=robo4 PE=4 SV=1
11	PDB:8eyyA	0.169	0.144	1.194E-8	775	0.052	0.043	8eyyA.pdb.gz
12	PDB:6pxvA	0.152	0.126	1.395E-8	823	0.056	0.043	6pxvA.pdb.gz
13	PDB:8dtlA	0.158	0.140	6.268E-8	741	0.051	0.043	8dtlA.pdb.gz
14	PDB:7u7nC	0.248	0.671	2.967E-7	200	0.049	0.155	7u7nC.pdb.gz
15	PDB:6pyhD	0.166	0.138	4.264E-7	798	0.067	0.053	6pyhD.pdb.gz
16	PDB:5mj3A	0.212	0.396	1.404E-6	302	0.062	0.129	5mj3A.pdb.gz
17	PDB:7z0lB	0.233	0.375	2.357E-6	370	0.051	0.086	7z0lB.pdb.gz
18	PDB:4ziqA	0.139	0.071	9.551E-6	1450	0.064	0.028	4ziqA.pdb.gz
19	PDB:5a42A	0.143	0.069	1.116E-5	1597	0.062	0.024	5a42A.pdb.gz
20	PDB:4lnvB	0.125	0.084	1.523E-5	1063	0.035	0.021	4lnvB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5VWK5	0.0	1306	629	1.000	1.000	IL23R_HUMAN Interleukin-23 receptor OS=Homo sapiens OX=9606 GN=IL23R PE=1 SV=3
2	Q8K4B4	0.0	889	644	0.688	0.672	IL23R_MOUSE Interleukin-23 receptor OS=Mus musculus OX=10090 GN=Il23r PE=2 SV=1
3	Q00560	2.85e-15	82.0	917	0.134	0.092	IL6RB_MOUSE Interleukin-6 receptor subunit beta OS=Mus musculus OX=10090 GN=Il6st PE=1 SV=2
4	P97378	1.11e-14	80.1	874	0.134	0.096	I12R2_MOUSE Interleukin-12 receptor subunit beta-2 OS=Mus musculus OX=10090 GN=Il12rb2 PE=1 SV=1
5	F1LRH7	5.31e-14	77.8	869	0.130	0.094	F1LRH7_RAT Interleukin 12 receptor subunit beta 2 OS=Rattus norvegicus OX=10116 GN=Il12rb2 PE=3 SV=2
6	P40190	1.00e-13	77.0	918	0.105	0.072	IL6RB_RAT Interleukin-6 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Il6st PE=1 SV=1
7	Q99665	6.83e-11	67.8	862	0.118	0.086	I12R2_HUMAN Interleukin-12 receptor subunit beta-2 OS=Homo sapiens OX=9606 GN=IL12RB2 PE=1 SV=1
8	A0A0A0MTN7	8.86e-11	67.0	549	0.118	0.135	A0A0A0MTN7_HUMAN Interleukin 12 receptor subunit beta 2 OS=Homo sapiens OX=9606 GN=IL12RB2 PE=1 SV=2
9	P40189	4.61e-10	65.1	918	0.099	0.068	IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2
10	Q17RA0	8.55e-10	64.3	918	0.099	0.068	Q17RA0_HUMAN Interleukin 6 signal transducer (Gp130, oncostatin M receptor) OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=1
11	Q99062	1.48e-09	63.5	836	0.087	0.066	CSF3R_HUMAN Granulocyte colony-stimulating factor receptor OS=Homo sapiens OX=9606 GN=CSF3R PE=1 SV=1
12	F1RCZ2	6.38e-09	61.6	859	0.118	0.086	F1RCZ2_DANRE Interleukin 6 cytokine family signal transduce OS=Danio rerio OX=7955 GN=gp130 PE=4 SV=2
13	P40223	6.88e-09	61.2	837	0.086	0.065	CSF3R_MOUSE Granulocyte colony-stimulating factor receptor OS=Mus musculus OX=10090 GN=Csf3r PE=1 SV=2
14	A8WH79	2.42e-08	59.7	866	0.114	0.083	A8WH79_DANRE Gp130 protein OS=Danio rerio OX=7955 GN=gp130 PE=2 SV=1
15	D4A3R0	6.34e-08	58.2	849	0.094	0.069	D4A3R0_RAT Colony stimulating factor 3 receptor OS=Rattus norvegicus OX=10116 GN=Csf3r PE=3 SV=2
16	A0A8I6B3M3	7.14e-07	55.1	877	0.054	0.039	A0A8I6B3M3_RAT Colony stimulating factor 3 receptor OS=Rattus norvegicus OX=10116 GN=Csf3r PE=3 SV=1
17	O75462	1.13e-06	53.9	422	0.087	0.130	CRLF1_HUMAN Cytokine receptor-like factor 1 OS=Homo sapiens OX=9606 GN=CRLF1 PE=1 SV=1
18	Q9JM58	1.56e-06	53.1	425	0.087	0.129	CRLF1_MOUSE Cytokine receptor-like factor 1 OS=Mus musculus OX=10090 GN=Crlf1 PE=1 SV=1
19	P42703	1.92e-06	53.5	1092	0.092	0.053	LIFR_MOUSE Leukemia inhibitory factor receptor OS=Mus musculus OX=10090 GN=Lifr PE=1 SV=1
20	P42702	2.64e-06	53.1	1097	0.097	0.056	LIFR_HUMAN Leukemia inhibitory factor receptor OS=Homo sapiens OX=9606 GN=LIFR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	2.3	20.0	Fibronectin type III domain
2	PF10420 IL12p40_C	1.2	21.0	Cytokine interleukin-12p40 C-terminus
3	PF18707 IL2RB_N1	9.7e+02	11.8	Interleukin-2 receptor subunit beta N-terminal domain 1
4	PF09240 IL6Ra-bind	2	20.3	Interleukin-6 receptor alpha chain, binding
5	PF06328 Lep_receptor_Ig	1.5e+02	13.8	Ig-like C2-type domain
6	PF18689 PriX	5e+02	12.4	Primase X

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321345

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000470788	0.999	Interleukin-12 receptor subunit beta-1
2	9606.ENSP00000228534	0.998	Interleukin-23 subunit alpha
3	9606.ENSP00000371067	0.996	Tyrosine-protein kinase JAK2
4	9606.ENSP00000231228	0.989	Interleukin-12 subunit beta
5	9606.ENSP00000431885	0.981	Non-receptor tyrosine-protein kinase TYK2
6	9606.ENSP00000264657	0.977	Signal transducer and activator of transcription 3
7	9606.ENSP00000376134	0.964	Signal transducer and activator of transcription 4
8	9606.ENSP00000357470	0.953	Interleukin-6 receptor subunit alpha
9	9606.ENSP00000354394	0.948	Signal transducer and activator of transcription 1-alpha/beta
10	9606.ENSP00000341208	0.943	Signal transducer and activator of transcription 5A
11	9606.ENSP00000330341	0.934	Suppressor of cytokine signaling 3
12	9606.ENSP00000216797	0.927	NF-kappa-B inhibitor alpha
13	9606.ENSP00000264832	0.921	Intercellular adhesion molecule 1
14	9606.ENSP00000226574	0.920	Nuclear factor NF-kappa-B p105 subunit
15	9606.ENSP00000365435	0.917	Tumor necrosis factor receptor superfamily member 1B
16	9606.ENSP00000305416	0.915	Sphingosine 1-phosphate receptor 1
17	9606.ENSP00000384273	0.913	Transcription factor p65
18	9606.ENSP00000484824	0.906	Mucin-1
19	9606.ENSP00000263967	0.900	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
20	9606.ENSP00000428056	0.900	Phosphatidylinositol 3-kinase regulatory subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019955	1.000	cytokine binding
GO:0070851	1.000	growth factor receptor binding
GO:0005126	1.000	cytokine receptor binding
GO:0004896	1.000	cytokine receptor activity
GO:0005143	0.664	interleukin-12 receptor binding
GO:0042019	0.660	interleukin-23 binding
GO:0042020	0.660	interleukin-23 receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048518	0.995	positive regulation of biological process
GO:0050896	0.994	response to stimulus
GO:0080090	0.991	regulation of primary metabolic process
GO:0051171	0.991	regulation of nitrogen compound metabolic process
GO:0010604	0.991	positive regulation of macromolecule metabolic process
GO:0042127	0.990	regulation of cell population proliferation
GO:0010468	0.987	regulation of gene expression
GO:0042327	0.985	positive regulation of phosphorylation
GO:0001934	0.980	positive regulation of protein phosphorylation
GO:0001817	0.977	regulation of cytokine production
GO:0001819	0.969	positive regulation of cytokine production
GO:0032946	0.966	positive regulation of mononuclear cell proliferation
GO:0050870	0.965	positive regulation of T cell activation
GO:0050730	0.963	regulation of peptidyl-tyrosine phosphorylation
GO:0042129	0.956	regulation of T cell proliferation
GO:0023051	0.955	regulation of signaling
GO:0010646	0.955	regulation of cell communication
GO:0009987	0.954	cellular process
GO:0023056	0.952	positive regulation of signaling
GO:0042102	0.952	positive regulation of T cell proliferation
GO:0010647	0.951	positive regulation of cell communication
GO:0080134	0.948	regulation of response to stress
GO:0009966	0.946	regulation of signal transduction
GO:0009967	0.941	positive regulation of signal transduction
GO:0044419	0.924	biological process involved in interspecies interaction between organisms
GO:0032101	0.914	regulation of response to external stimulus
GO:0050731	0.914	positive regulation of peptidyl-tyrosine phosphorylation
GO:0031347	0.907	regulation of defense response
GO:0043207	0.901	response to external biotic stimulus
GO:0042531	0.901	positive regulation of tyrosine phosphorylation of STAT protein
GO:0051716	0.895	cellular response to stimulus
GO:0050776	0.894	regulation of immune response
GO:0002376	0.892	immune system process
GO:0051707	0.889	response to other organism
GO:0042221	0.879	response to chemical
GO:0010033	0.860	response to organic substance
GO:0048519	0.859	negative regulation of biological process
GO:0006952	0.858	defense response
GO:0050793	0.857	regulation of developmental process
GO:0006955	0.857	immune response
GO:0023052	0.825	signaling
GO:0007154	0.824	cell communication
GO:0034097	0.814	response to cytokine
GO:0007165	0.760	signal transduction
GO:0045595	0.740	regulation of cell differentiation
GO:0046634	0.707	regulation of alpha-beta T cell activation
GO:0046006	0.693	regulation of activated T cell proliferation
GO:2000026	0.655	regulation of multicellular organismal development
GO:0098542	0.649	defense response to other organism
GO:0050778	0.645	positive regulation of immune response
GO:0044093	0.634	positive regulation of molecular function
GO:1904892	0.627	regulation of receptor signaling pathway via STAT
GO:1903706	0.610	regulation of hemopoiesis
GO:0010605	0.602	negative regulation of macromolecule metabolic process
GO:1904894	0.578	positive regulation of receptor signaling pathway via STAT
GO:0051094	0.573	positive regulation of developmental process
GO:0032649	0.567	regulation of type II interferon production
GO:0046635	0.531	positive regulation of alpha-beta T cell activation
GO:0070887	0.449	cellular response to chemical stimulus
GO:0007166	0.443	cell surface receptor signaling pathway
GO:0071310	0.442	cellular response to organic substance
GO:0046425	0.433	regulation of receptor signaling pathway via JAK-STAT
GO:0032729	0.420	positive regulation of type II interferon production
GO:0045597	0.414	positive regulation of cell differentiation
GO:0046427	0.411	positive regulation of receptor signaling pathway via JAK-STAT
GO:1902105	0.401	regulation of leukocyte differentiation
GO:1902107	0.379	positive regulation of leukocyte differentiation
GO:0048523	0.358	negative regulation of cellular process
GO:0009617	0.353	response to bacterium
GO:1901700	0.349	response to oxygen-containing compound
GO:0045637	0.348	regulation of myeloid cell differentiation
GO:0045639	0.343	positive regulation of myeloid cell differentiation
GO:0050790	0.337	regulation of catalytic activity
GO:0032816	0.334	positive regulation of natural killer cell activation
GO:0002822	0.327	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0071345	0.324	cellular response to cytokine stimulus
GO:0002761	0.321	regulation of myeloid leukocyte differentiation
GO:0051241	0.308	negative regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.997	protein-containing complex
GO:0043235	0.829	receptor complex
GO:0098796	0.789	membrane protein complex
GO:0098797	0.712	plasma membrane protein complex
GO:0043227	0.684	membrane-bounded organelle
GO:0098802	0.657	plasma membrane signaling receptor complex
GO:0043231	0.582	intracellular membrane-bounded organelle
GO:0005737	0.395	cytoplasm
GO:0072536	0.368	interleukin-23 receptor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]