StarFunc result for job id Q5VWN6

User Input

>input (2430 residues)
MAPPAHKSILERSENVLMSPWKGKLIVQDRMLCDIALWSTYGAMIPTQLPQELDFKYVMK
VSSLKKRLPEAAFRKQNYLEEKVCFQDLCFNLYEVELSNRQGENIDKLTECIKNKQLAII
KCLEDRGFFILLTSSALLSEPDFGGKQMGLHGLHLFRSPLSTGVKDLKVEDDISMKVIPI
LSTLNCALLETKKSLPEERIHPNTLVKRHFQELYKADRSPSLSVAPQDRMKDPTFLGKLP
SGFDLIPPAEKCPSESLTQLNSYFSDPSAYILEVSTALDLLAEHPQSPCVSDGICDAGFS
LVMTPDPEFLVSEAEVRKETETKKDSEEMLKAKKRVFPLSPASNLRVQPKRKASMPHMVQ
SKKVNLCRPFPKRTASRADNSSDSPTTLKLVKGQFPQKRKRGAEVLTAQFVQKTKLDRKN
QEAPISKDVPVPTNAKRARKQEKSPVKTVPRAKPPVKKSPQKQRVNIVKGNENPRNRKQL
QPVKGETASKLQSEISRGCQEDGISINSVQPENTTAAHNDLPENSIVNYDSQALNMLADL
ALSSATSSTPVSEARNLHCSSELPQNDVLLSKENSLRGTSDHEYHRGVKTQKGELLPNPS
SDRKSNSGSDLTVSQDEESLVPCSQAPAKAQSALTEEMLESSDASQSSSVSVEHSYALLL
TEHSKKHLQEREILSPLFPRNGTKSPEAATPVGKVMPFRHQPGLLLQQKPPDDPVVKPKD
RPPSARVKKSSCSRIVLSCDDSVKITFKCETEYAFSLDSKYTNNPLEKTVVRALHGPWNT
DLPDNVEEVKLLLHMWVALFYSNQNKIIRSSRKVVEHSNPAKYVSINSTLESCELREIEE
SLGLEKCSADSLLETNEISRAHAAEVSFRDPNCLLPFIKTPLTQGLELCVQNEQKKTFAR
ECDPDTQEDQNFICSYNNEVTGEEAKQESLETSNLVLSGIGSTQTNGPSVPSEEEIVQPL
DSTRVASYSGTVTQATFTRTYDGPGSQPVICQSSVYGTLENKVDILDAAVQTKTGTLQDL
IQHGSPINNECHPSLERKDDNMGCAVINPEPITLTFEKNAHVPIQTEGVNTADERTTFKK
ELIKQVSPAASLRHPVSTSENARTQGLRDIPSLVVAGQKGTKYLCASSVGGETLDKAVCS
LQKETPLPVSLPSDKTMVMEALSLAKSSSHLSPSEEVRCTQDFLSQTQSLLGLSSEGLLE
LTQVEVDSSSASTTLGRQCSLNCISSGCHTSGDSLELRKNHKNGPNTENMNLEAFDSVFI
KQTSLSVSREVSLELSEEDSDIDLALTISPPTSPREEMPAGEIEQFEEAPFSNLELQDVA
EEIGEPEEVALTESREVSSADNVSVYPSVSEEPVENKERKGDNLQPVTLILSKENCTLEI
AEEINVTSDFPFDSVIEEVSPASSPEPPVPVKETRPYQAVTPCILKLHGTQCEKSNQISQ
CESEDLGITEKENVFVGPTHPVGQDNFTQVQQMQVSAEMPLILTDHPGRTGRPTLPGKVT
EEIVSSEHDEGLSFSGKVQCYGRELNQPASAAKCTGDFSPSPEKLVKSGNPLQPVSIENR
NLDLKHLVLESSEPPFGPRNVIENKSLSDTLVSTTAPSGIVNVSVKQQTSPKSSQNHLFP
GDLKTDEGIYLQVKSLTAASVDGAYSTQGCMCSVVPTLCSSSDNATLTHYVRPINAEPVF
QAQEIPAGRMASLLKNGEPEAELHKETTGPGTAGPQSNTTSSLKGERKAIHTLQDVSTCE
TKELLNVGVSSLCAGPYQNTADTKENLSKEPLASFVSESFDTSVCGIATEHVEIENSGEG
LRAEAGSETLGRDGEVGVNSDMHYELSGDSDLDLLGDCRNPRLDLEDSYTLRGSYTRKKD
VPTDGYESSLNFHNNNQEDWGCSSWVPGMETSLPPGHWTAAVKKEEKCVPPYVQIRDLHG
ILRTYANFSITKELKDTMRTSHGLRRHPSFSANCGLPSSWTSTWQVADDLTQNTLDLEYL
RFAHKLKQTIKNGDSQHSASSANVFPKESPTQISIGAFPSTKISEAPFLHPAPRSRSPLL
VTVVESDPRPQGQPRRGYTASSLDSSSSWRERCSHNRDLRNSQRNHTVSFHLNKLKYNST
VKESRNDISLILNEYAEFNKVMKNSNQFIFQDKELNDVSGEATAQEMYLPFPGRSASYED
IIIDVCTNLHVKLRSVVKEACKSTFLFYLVETEDKSFFVRTKNLLRKGGHTEIEPQHFCQ
AFHRENDTLIIIIRNEDISSHLHQIPSLLKLKHFPSVIFAGVDSPGDVLDHTYQELFRAG
GFVISDDKILEAVTLVQLKEIIKILEKLNGNGRWKWLLHYRENKKLKEDERVDSTAHKKN
IMLKSFQSANIIELLHYHQCDSRSSTKAEILKCLLNLQIQHIDARFAVLLTDKPTIPREV
FENSGILVTDVNNFIENIEKIAAPFRSSYW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VWN6	1.000	1.000	0.000	2430	1.000	1.000	Q5VWN6.pdb.gz	TASO2_HUMAN Protein TASOR 2 OS=Homo sapiens OX=9606 GN=TASOR2 PE=1 SV=1
2	PDB:5y58A	0.040	0.145	4.494E-5	548	0.014	0.060	5y58A.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres
3	AFDB:Q54S20	0.036	0.033	1.441E-4	2678	0.119	0.108	Q54S20.pdb.gz	MED13_DICDI Mediator of RNA polymerase II transcription subunit 13 OS=Dictyostelium discoideum OX=44689 GN=amiB PE=2 SV=1
4	PDB:7nfcC	0.038	0.152	5.416E-4	477	0.018	0.090	7nfcC.pdb.gz	Cryo-EM of NHEJ supercomplexes provides insights into DNA repair.
5	AFDB:A0A0B4JCZ8	0.024	0.026	1.116E-3	2028	0.115	0.138	A0A0B4JCZ8.pdb.gz	A0A0B4JCZ8_DROME Missing-in-metastasis, isoform F OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
6	AFDB:P10070	0.027	0.037	1.317E-3	1586	0.095	0.146	P10070.pdb.gz	GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens OX=9606 GN=GLI2 PE=1 SV=4
7	AFDB:P10071	0.028	0.035	1.392E-3	1580	0.095	0.146	P10071.pdb.gz	GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens OX=9606 GN=GLI3 PE=1 SV=6
8	AFDB:Q8MSX1	0.027	0.028	1.940E-3	1818	0.111	0.148	Q8MSX1.pdb.gz	ENC_DROME Protein encore OS=Drosophila melanogaster OX=7227 GN=enc PE=1 SV=2
9	AFDB:B7SY83	0.052	0.081	2.421E-3	1477	0.092	0.151	B7SY83.pdb.gz	PS1_ARATH FHA domain-containing protein PS1 OS=Arabidopsis thaliana OX=3702 GN=PS1 PE=2 SV=1
10	PDB:6sn1B	0.039	0.166	2.549E-3	503	0.011	0.054	6sn1B.pdb.gz
11	AFDB:A0A2R8QMX9	0.029	0.040	2.858E-3	1443	0.090	0.151	A0A2R8QMX9.pdb.gz
12	PDB:7airA	0.048	0.094	3.361E-3	885	0.013	0.036	7airA.pdb.gz	Phospho-regulation, nucleotide binding and ion access control in potassium-chloride cotransporters.
13	AFDB:Q80U93	0.026	0.028	3.768E-3	2085	0.102	0.119	Q80U93.pdb.gz	NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus OX=10090 GN=Nup214 PE=1 SV=2
14	PDB:7k0yC	0.036	0.108	4.193E-3	655	0.016	0.060	7k0yC.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.
15	AFDB:Q9W1A9	0.026	0.029	8.175E-3	2291	0.108	0.114	Q9W1A9.pdb.gz	Q9W1A9_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=enok PE=1 SV=2
16	PDB:6joxA	0.046	0.237	9.614E-3	245	0.009	0.086	6joxA.pdb.gz
17	PDB:5y58B	0.032	0.115	1.497E-2	568	0.009	0.040	5y58B.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres
18	PDB:1tpfA	0.042	0.206	2.204E-2	250	0.007	0.068	1tpfA.pdb.gz
19	PDB:6zheC	0.044	0.129	2.204E-2	705	0.018	0.061	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
20	PDB:7d5s5K	0.040	0.397	3.247E-2	175	0.007	0.097	7d5s5K.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8YH03	0.0	5005	2645	1.000	0.919	A0A2R8YH03_HUMAN Transcription activation suppressor family member 2 OS=Homo sapiens OX=9606 GN=TASOR2 PE=1 SV=1
2	Q5VWN6	0.0	5007	2430	1.000	1.000	TASO2_HUMAN Protein TASOR 2 OS=Homo sapiens OX=9606 GN=TASOR2 PE=1 SV=1
3	A0A087X0F1	1.13e-45	183	1035	0.041	0.097	A0A087X0F1_HUMAN Transcription activation suppressor OS=Homo sapiens OX=9606 GN=TASOR PE=1 SV=1
4	Q9UK61	2.34e-45	184	1670	0.041	0.060	TASOR_HUMAN Protein TASOR OS=Homo sapiens OX=9606 GN=TASOR PE=1 SV=3
5	Q69ZR9	1.40e-44	181	1610	0.041	0.062	TASOR_MOUSE Protein TASOR OS=Mus musculus OX=10090 GN=Tasor PE=1 SV=2
6	Q38BC5	0.89	36.6	242	0.014	0.136	Q38BC5_TRYB2 ER membrane protein complex subunit 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2450 PE=3 SV=1
7	P48802	1.7	35.8	256	0.008	0.074	FGF3_DANRE Fibroblast growth factor 3 OS=Danio rerio OX=7955 GN=fgf3 PE=1 SV=1
8	Q9HCJ0	2.9	35.8	1690	0.019	0.027	TNR6C_HUMAN Trinucleotide repeat-containing gene 6C protein OS=Homo sapiens OX=9606 GN=TNRC6C PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12480 DUF3699	6.8e-25	98.3	Protein of unknown function (DUF3699)
2	PF12509 DUF3715	2.5e-47	172.0	Protein of unknown function (DUF3715)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328426

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383145	0.722	Protein SFI1 homolog
2	9606.ENSP00000317790	0.705	Spectrin beta, non-erythrocytic 5
3	9606.ENSP00000265843	0.702	Exophilin-5
4	9606.ENSP00000389843	0.650	Sodium-coupled neutral amino acid transporter 4
5	9606.ENSP00000305892	0.630	Transmembrane protein 208
6	9606.ENSP00000364295	0.625	Lysosomal amino acid transporter 1 homolog
7	9606.ENSP00000406220	0.579	Solute carrier family 13 member 5
8	9606.ENSP00000333802	0.564	Zinc finger protein 599
9	9606.ENSP00000365619	0.518	Zinc finger protein 337

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050794	0.912	regulation of cellular process
GO:0051179	0.496	localization
GO:0071704	0.469	organic substance metabolic process
GO:0044238	0.459	primary metabolic process
GO:0044237	0.457	cellular metabolic process
GO:0006807	0.443	nitrogen compound metabolic process
GO:0034641	0.308	cellular nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]