StarFunc result for job id Q5VWQ8

User Input

>input (1189 residues)
MSAGGSARKSTGRSSYYYRLLRRPRLQRQRSRSRSRTRPARESPQERPGSRRSLPGSLSE
KSPSMEPSAATPFRVTGFLSRRLKGSIKRTKSQPKLDRNHSFRHILPGFRSAAAAAADNE
RSHLMPRLKESRSHESLLSPSSAVEALDLSMEEEVVIKPVHSSILGQDYCFEVTTSSGSK
CFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDV
LYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAAS
VAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGLC
AALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATK
AIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSAADLPEHQGNLKMCCELAFC
KIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQ
EYPDDRTARTLTLIAKVTQNLANFAKFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNPET
LSNTAGFEGYIDLGRELSSLHSLLWEAVSQLEQSIVSKLGPLPRILRDVHTALSTPGSGQ
LPGTNDLASTPGSGSSSISAGLQKMVIENDLSGLIDFTRLPSPTPENKDLFFVTRSSGVQ
PSPARSSSYSEANEPDLQMANGGKSLSMVDLQDARTLDGEAGSPAGPDVLPTDGQAAAAQ
LVAGWPARATPVNLAGLATVRRAGQTPTTPGTSEGAPGRPQLLAPLSFQNPVYQMAAGLP
LSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSTAAEELARRPGELARRQMSLTEKG
GQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPNLLSTLQYPRPSSGTLASASPDW
VGPSTRLRQQSSSSKGDSPELKPRAVHKQGPSPVSPNALDRTAAWLLTMNAQLLEDEGLG
PDPPHRDRLRSKDELSQAEKDLAVLQDKLRISTKKLEEYETLFKCQEETTQKLVLEYQAR
LEEGEERLRRQQEDKDIQMKGIISRLMSVEEELKKDHAEMQAAVDSKQKIIDAQEKRIAS
LDAANARLMSALTQLKERYSMQARNGISPTNPTKLQITENGEFRNSSNC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UHC7	0.706	0.706	0.000	1189	0.973	0.973	Q3UHC7.pdb.gz	DAB2P_MOUSE Disabled homolog 2-interacting protein OS=Mus musculus OX=10090 GN=Dab2ip PE=1 SV=1
2	AFDB:Q96PV0	0.495	0.443	7.632E-84	1343	0.507	0.449	Q96PV0.pdb.gz	SYGP1_HUMAN Ras/Rap GTPase-activating protein SynGAP OS=Homo sapiens OX=9606 GN=SYNGAP1 PE=1 SV=4
3	AFDB:E9QHX3	0.442	0.422	4.641E-80	1246	0.466	0.445	E9QHX3.pdb.gz
4	AFDB:Q8T498	0.420	0.319	5.978E-56	1580	0.331	0.249	Q8T498.pdb.gz	GAP2_DROME Ras GTPase-activating protein raskol OS=Drosophila melanogaster OX=7227 GN=raskol PE=1 SV=3
5	PDB:7pgrN	0.225	0.116	9.132E-12	2423	0.076	0.037	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
6	PDB:7r04A	0.232	0.121	1.779E-11	2326	0.075	0.038	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
7	PDB:7mp5A	0.217	0.160	3.303E-11	1629	0.073	0.053	7mp5A.pdb.gz
8	PDB:7r03B	0.220	0.120	3.464E-11	2246	0.075	0.040	7r03B.pdb.gz
9	PDB:7r04B	0.215	0.117	1.035E-10	2229	0.073	0.039	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
10	PDB:1cjyA	0.091	0.166	4.512E-7	633	0.045	0.085	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
11	PDB:6pyuA	0.082	0.103	3.963E-5	930	0.057	0.073	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
12	PDB:6kz8A	0.089	0.133	6.380E-5	784	0.019	0.028	6kz8A.pdb.gz	Crystal structure of plant PLD alpha 1 reveals catalytic and regulatory mechanisms of eukaryotic phospholipase D.
13	PDB:6gy0A	0.084	0.118	1.027E-4	822	0.054	0.078	6gy0A.pdb.gz	A class of highly selective inhibitors bind to an active state of PI3K gamma.
14	PDB:5iz5A	0.091	0.140	1.077E-4	757	0.017	0.026	5iz5A.pdb.gz
15	AFDB:Q9BZQ8	0.070	0.081	6.958E-4	928	0.076	0.097	Q9BZQ8.pdb.gz	NIBA1_HUMAN Protein Niban 1 OS=Homo sapiens OX=9606 GN=NIBAN1 PE=1 SV=1
16	AFDB:F4I133	0.078	0.089	1.355E-3	963	0.102	0.126	F4I133.pdb.gz	F4I133_ARATH Cysteine proteinases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=ASP1 PE=1 SV=1
17	AFDB:F1R8J2	0.069	0.049	2.400E-3	2014	0.119	0.071	F1R8J2.pdb.gz
18	AFDB:O95490	0.059	0.049	2.639E-3	1459	0.093	0.075	O95490.pdb.gz	AGRL2_HUMAN Adhesion G protein-coupled receptor L2 OS=Homo sapiens OX=9606 GN=ADGRL2 PE=1 SV=2
19	AFDB:Q96JE7	0.065	0.070	3.044E-3	1060	0.125	0.141	Q96JE7.pdb.gz	SC16B_HUMAN Protein transport protein Sec16B OS=Homo sapiens OX=9606 GN=SEC16B PE=1 SV=2
20	AFDB:Q27J81	0.039	0.037	9.545E-3	1249	0.114	0.109	Q27J81.pdb.gz	INF2_HUMAN Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3YUS5	0.0	1241	1261	0.572	0.539	D3YUS5_MOUSE RAS protein activator like 2 OS=Mus musculus OX=10090 GN=Rasal2 PE=1 SV=1
2	E7F1U4	0.0	908	1507	0.379	0.299	E7F1U4_DANRE Ras/Rap GTPase-activating protein SynGAP1b OS=Danio rerio OX=7955 GN=si:dkey-246f6.1 PE=1 SV=4
3	E9PW37	0.0	1236	1286	0.573	0.530	E9PW37_MOUSE RAS protein activator like 2 OS=Mus musculus OX=10090 GN=Rasal2 PE=1 SV=1
4	F6SEU4	0.0	1033	1340	0.518	0.460	SYGP1_MOUSE Ras/Rap GTPase-activating protein SynGAP OS=Mus musculus OX=10090 GN=Syngap1 PE=1 SV=2
5	Q0VAV5	0.0	1234	1268	0.572	0.536	Q0VAV5_MOUSE RAS protein activator like 2 OS=Mus musculus OX=10090 GN=Rasal2 PE=2 SV=1
6	Q3UHC7	0.0	2395	1189	0.974	0.974	DAB2P_MOUSE Disabled homolog 2-interacting protein OS=Mus musculus OX=10090 GN=Dab2ip PE=1 SV=1
7	Q5VWQ8	0.0	2445	1189	1.000	1.000	DAB2P_HUMAN Disabled homolog 2-interacting protein OS=Homo sapiens OX=9606 GN=DAB2IP PE=1 SV=2
8	Q6P730	0.0	2015	996	0.818	0.977	DAB2P_RAT Disabled homolog 2-interacting protein OS=Rattus norvegicus OX=10116 GN=Dab2ip PE=1 SV=1
9	Q96PV0	0.0	1033	1343	0.520	0.460	SYGP1_HUMAN Ras/Rap GTPase-activating protein SynGAP OS=Homo sapiens OX=9606 GN=SYNGAP1 PE=1 SV=4
10	Q9QUH6	0.0	1013	1308	0.505	0.459	SYGP1_RAT Ras/Rap GTPase-activating protein SynGAP OS=Rattus norvegicus OX=10116 GN=Syngap1 PE=1 SV=2
11	Q9UJF2	0.0	1235	1139	0.571	0.596	NGAP_HUMAN Ras GTPase-activating protein nGAP OS=Homo sapiens OX=9606 GN=RASAL2 PE=1 SV=2
12	Q8T498	8.48e-143	472	1580	0.213	0.160	GAP2_DROME Ras GTPase-activating protein raskol OS=Drosophila melanogaster OX=7227 GN=raskol PE=1 SV=3
13	Q86YV0	8.65e-141	454	1011	0.215	0.253	RASL3_HUMAN RAS protein activator like-3 OS=Homo sapiens OX=9606 GN=RASAL3 PE=1 SV=2
14	Q8MLZ5	2.31e-139	455	1207	0.210	0.207	GAP2_CAEEL Ras GTPase-activating protein gap-2 OS=Caenorhabditis elegans OX=6239 GN=gap-2 PE=2 SV=2
15	D3YWZ9	2.23e-103	331	323	0.137	0.505	D3YWZ9_MOUSE RAS protein activator like 2 (Fragment) OS=Mus musculus OX=10090 GN=Rasal2 PE=1 SV=1
16	Q8BU92	1.29e-100	326	383	0.134	0.415	Q8BU92_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Rasal2 PE=2 SV=2
17	D3Z1T6	3.11e-67	226	176	0.099	0.670	D3Z1T6_MOUSE RAS protein activator like 2 (Fragment) OS=Mus musculus OX=10090 GN=Rasal2 PE=1 SV=1
18	E9PYG6	7.99e-45	179	1038	0.127	0.145	E9PYG6_MOUSE RAS p21 protein activator 1 OS=Mus musculus OX=10090 GN=Rasa1 PE=1 SV=1
19	P50904	8.64e-45	179	1038	0.127	0.145	RASA1_RAT Ras GTPase-activating protein 1 OS=Rattus norvegicus OX=10116 GN=Rasa1 PE=1 SV=1
20	Q91YX7	1.17e-44	177	813	0.127	0.186	Q91YX7_MOUSE RAS p21 protein activator 1 OS=Mus musculus OX=10090 GN=Rasa1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05791 Bacillus_HBL	0.43	21.9	Bacillus haemolytic enterotoxin (HBL)
2	PF00168 C2	0.00036	32.1	C2 domain
3	PF12004 DUF3498	5.2e-205	694.2	Domain of unknown function (DUF3498)
4	PF14000 Packaging_FI	3.7e+02	13.0	DNA packaging protein FI
5	PF00169 PH	54	15.7	PH domain
6	PF08458 PH_2	88	14.9	Plant pleckstrin homology-like region
7	PF00616 RasGAP	9.5e-24	95.8	GTPase-activator protein for Ras-like GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 10160.XP_004641543.1

Rank	PPI partner	STRING score	Description
1	10160.XP_004628630.1	0.999	Mitogen-activated protein kinase kinase kinase 5
2	10160.XP_004640436.1	0.998	TNF receptor-associated factor 2
3	10160.XP_004642922.1	0.951	Mitogen-activated protein kinase kinase kinase 6
4	10160.XP_004639805.1	0.934	Tumor necrosis factor receptor superfamily member 1B
5	10160.XP_004625813.1	0.933	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: inserted 2 bases in 1 codon
6	10160.XP_004641532.1	0.869	TNF receptor-associated factor 1
7	10160.XP_004638006.1	0.865	GTPase HRas
8	10160.XP_004624290.1	0.864	Ras GTPase-activating protein SynGAP
9	10160.XP_004634619.1	0.826	GTPase KRas isoform X1
10	10160.XP_004627632.1	0.825	E3 ubiquitin-protein ligase LNX
11	10160.XP_004641734.1	0.812	Upstream in-frame stop codon
12	10160.XP_004643255.1	0.812	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins
13	10160.XP_004635002.1	0.809	Ras-related protein R-Ras2
14	10160.XP_004645514.1	0.802	Rap guanine nucleotide exchange factor 2
15	10160.XP_004630176.1	0.798	Exocyst complex component 7 isoform X1
16	10160.XP_004643551.1	0.797	FCH domain only protein 2
17	10160.XP_004646697.1	0.788	Epidermal growth factor receptor
18	10160.XP_004633766.1	0.787	Receptor tyrosine-protein kinase erbB-2
19	10160.XP_004625038.1	0.785	Ras-related protein M-Ras
20	10160.XP_004626661.1	0.785	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 9 Proteins

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding
GO:0030234	0.990	enzyme regulator activity
GO:0140677	0.986	molecular function activator activity
GO:0008047	0.983	enzyme activator activity
GO:0030695	0.683	GTPase regulator activity
GO:0005096	0.523	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.983	regulation of cellular process
GO:0050896	0.977	response to stimulus
GO:0032502	0.977	developmental process
GO:0009987	0.969	cellular process
GO:0048856	0.964	anatomical structure development
GO:0051128	0.958	regulation of cellular component organization
GO:0048519	0.956	negative regulation of biological process
GO:0032501	0.955	multicellular organismal process
GO:0048583	0.949	regulation of response to stimulus
GO:0010941	0.940	regulation of cell death
GO:0048523	0.937	negative regulation of cellular process
GO:0009966	0.937	regulation of signal transduction
GO:0050793	0.927	regulation of developmental process
GO:1902531	0.923	regulation of intracellular signal transduction
GO:0007275	0.912	multicellular organism development
GO:0071495	0.907	cellular response to endogenous stimulus
GO:0010033	0.907	response to organic substance
GO:0051716	0.906	cellular response to stimulus
GO:0007165	0.904	signal transduction
GO:0051239	0.900	regulation of multicellular organismal process
GO:0019222	0.893	regulation of metabolic process
GO:0048522	0.878	positive regulation of cellular process
GO:0008152	0.877	metabolic process
GO:0051174	0.874	regulation of phosphorus metabolic process
GO:0022603	0.861	regulation of anatomical structure morphogenesis
GO:0001934	0.859	positive regulation of protein phosphorylation
GO:0043408	0.858	regulation of MAPK cascade
GO:0009653	0.829	anatomical structure morphogenesis
GO:0071704	0.828	organic substance metabolic process
GO:2000026	0.827	regulation of multicellular organismal development
GO:0051347	0.811	positive regulation of transferase activity
GO:1902533	0.797	positive regulation of intracellular signal transduction
GO:0046580	0.795	negative regulation of Ras protein signal transduction
GO:0030334	0.787	regulation of cell migration
GO:0045860	0.784	positive regulation of protein kinase activity
GO:0043170	0.780	macromolecule metabolic process
GO:0071363	0.768	cellular response to growth factor stimulus
GO:0042127	0.753	regulation of cell population proliferation
GO:1901700	0.742	response to oxygen-containing compound
GO:0048513	0.700	animal organ development
GO:0048731	0.698	system development
GO:0051241	0.695	negative regulation of multicellular organismal process
GO:1901701	0.685	cellular response to oxygen-containing compound
GO:0043410	0.678	positive regulation of MAPK cascade
GO:0007166	0.668	cell surface receptor signaling pathway
GO:0051093	0.666	negative regulation of developmental process
GO:0043405	0.661	regulation of MAP kinase activity
GO:0044238	0.653	primary metabolic process
GO:0071840	0.645	cellular component organization or biogenesis
GO:0030154	0.644	cell differentiation
GO:0042981	0.643	regulation of apoptotic process
GO:0016043	0.632	cellular component organization
GO:0010468	0.629	regulation of gene expression
GO:0001933	0.623	negative regulation of protein phosphorylation
GO:0006469	0.601	negative regulation of protein kinase activity
GO:0012501	0.596	programmed cell death
GO:0006915	0.585	apoptotic process
GO:0035556	0.570	intracellular signal transduction
GO:0043406	0.529	positive regulation of MAP kinase activity
GO:0035924	0.477	cellular response to vascular endothelial growth factor stimulus
GO:0006807	0.472	nitrogen compound metabolic process
GO:0007399	0.469	nervous system development
GO:0044237	0.444	cellular metabolic process
GO:0048468	0.435	cell development
GO:0009605	0.401	response to external stimulus
GO:0006950	0.395	response to stress
GO:0071901	0.394	negative regulation of protein serine/threonine kinase activity
GO:0051094	0.363	positive regulation of developmental process
GO:0022008	0.359	neurogenesis
GO:0019538	0.320	protein metabolic process
GO:0065008	0.315	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043226	0.998	organelle
GO:0005886	0.997	plasma membrane
GO:0043229	0.990	intracellular organelle
GO:0005829	0.990	cytosol
GO:0043231	0.983	intracellular membrane-bounded organelle
GO:0032991	0.975	protein-containing complex
GO:0120025	0.842	plasma membrane bounded cell projection
GO:0043005	0.745	neuron projection
GO:0036477	0.709	somatodendritic compartment
GO:1990032	0.384	parallel fiber
GO:0044301	0.384	climbing fiber
GO:0044300	0.374	cerebellar mossy fiber
GO:1990597	0.368	AIP1-IRE1 complex
GO:0030139	0.364	endocytic vesicle
GO:0044297	0.338	cell body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]