StarFunc result for job id Q5VWX1

User Input

>input (349 residues)
MEEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKL
SERVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSG
EAKYAHLSDELHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNG
SEDSGRGRGIRGRGIRIAPTAPSRGRGGAIPPPPPPGRGVLTPRGSTVTRGALPVPPVAR
GVPTPRARGAPTVPGYRAPPPPAHEAYEEYGYDDGYGGEYDDQTYETYDNSYATQTQSVP
EYYDYGHGVSEDAYDSYAPEEWATTRSSLKAPPQRSARGGYREHPYGRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VWX1	1.000	1.000	4.127E-59	349	1.000	1.000	Q5VWX1.pdb.gz	KHDR2_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Homo sapiens OX=9606 GN=KHDRBS2 PE=1 SV=1
2	AFDB:O75525	0.409	0.413	4.588E-38	346	0.673	0.679	O75525.pdb.gz	KHDR3_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Homo sapiens OX=9606 GN=KHDRBS3 PE=1 SV=1
3	AFDB:Q8UUW7	0.445	0.365	4.067E-36	433	0.636	0.513	Q8UUW7.pdb.gz	KHDR1_CHICK KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Gallus gallus OX=9031 GN=KHDRBS1 PE=2 SV=1
4	AFDB:Q07666	0.483	0.390	1.604E-34	443	0.636	0.501	Q07666.pdb.gz	KHDR1_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1 PE=1 SV=1
5	AFDB:Q6NW62	0.531	0.527	2.058E-34	352	0.579	0.574	Q6NW62.pdb.gz	Q6NW62_DANRE KH domain-containing, RNA-binding, signal transduction-associated 1b OS=Danio rerio OX=7955 GN=sb:cb97 PE=1 SV=1
6	AFDB:A0A0R4ISK8	0.434	0.388	7.244E-28	395	0.458	0.405	A0A0R4ISK8.pdb.gz
7	AFDB:O44435	0.392	0.347	2.538E-23	396	0.338	0.298	O44435.pdb.gz	O44435_DROME QKR58E-1 OS=Drosophila melanogaster OX=7227 GN=qkr58E-1 PE=2 SV=1
8	AFDB:Q7KNS5	0.400	0.328	4.187E-22	428	0.361	0.294	Q7KNS5.pdb.gz	Q7KNS5_DROME Quaking related 54B, isoform A OS=Drosophila melanogaster OX=7227 GN=qkr54B PE=1 SV=1
9	AFDB:Q8T8U7	0.386	0.486	6.502E-20	275	0.238	0.302	Q8T8U7.pdb.gz	Q8T8U7_DROME AT29209p OS=Drosophila melanogaster OX=7227 GN=CG3927 PE=2 SV=1
10	AFDB:Q9W224	0.374	0.384	1.995E-19	340	0.278	0.285	Q9W224.pdb.gz	Q9W224_DROME Novel spermatogenesis regulator, isoform A OS=Drosophila melanogaster OX=7227 GN=nsr PE=4 SV=2
11	PDB:6ke6RC	0.132	0.162	1.551E-2	278	0.072	0.090	6ke6RC.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
12	PDB:6zqbJO	0.181	0.256	3.078E-2	236	0.049	0.072	6zqbJO.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
13	PDB:7mq8NY	0.178	0.220	3.710E-2	274	0.057	0.073	7mq8NY.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7mqaSW	0.191	0.326	4.760E-2	195	0.043	0.077	7mqaSW.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:3j4sA	0.105	0.093	1.212E-1	414	0.077	0.065	3j4sA.pdb.gz	Bacterial tubulin TubZ-Bt transitions between a two-stranded intermediate and a four-stranded filament upon GTP hydrolysis.
16	PDB:7ajuJJ	0.181	0.297	2.723E-1	199	0.037	0.065	7ajuJJ.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	PDB:6w17D	0.146	0.163	5.750E-1	301	0.037	0.043	6w17D.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.
18	PDB:5xteK	0.144	0.125	6.931E-1	419	0.040	0.033	5xteK.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
19	PDB:6pwnA	0.093	0.114	6.931E-1	280	0.040	0.050	6pwnA.pdb.gz
20	PDB:3cw2C	0.129	0.161	7.376E-1	266	0.029	0.038	3cw2C.pdb.gz	Crystal structure of the intact archaeal translation initiation factor 2 demonstrates very high conformational flexibility in the alpha- and beta-subunits.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5VWX1	0.0	699	349	1.000	1.000	KHDR2_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Homo sapiens OX=9606 GN=KHDRBS2 PE=1 SV=1
2	Q920F3	0.0	560	349	0.954	0.954	KHDR2_RAT KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Khdrbs2 PE=1 SV=1
3	Q9WU01	0.0	600	349	0.954	0.954	KHDR2_MOUSE KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Mus musculus OX=10090 GN=Khdrbs2 PE=1 SV=1
4	Q9R226	1.59e-152	434	346	0.679	0.685	KHDR3_MOUSE KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Mus musculus OX=10090 GN=Khdrbs3 PE=1 SV=1
5	O75525	4.51e-149	425	346	0.670	0.676	KHDR3_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Homo sapiens OX=9606 GN=KHDRBS3 PE=1 SV=1
6	Q9JLP1	1.08e-148	424	346	0.665	0.671	KHDR3_RAT KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Rattus norvegicus OX=10116 GN=Khdrbs3 PE=1 SV=1
7	Q91V33	5.93e-134	390	443	0.622	0.490	KHDR1_RAT KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Khdrbs1 PE=1 SV=1
8	Q60749	1.27e-133	390	443	0.622	0.490	KHDR1_MOUSE KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Mus musculus OX=10090 GN=Khdrbs1 PE=1 SV=2
9	Q07666	1.92e-130	382	443	0.630	0.497	KHDR1_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1 PE=1 SV=1
10	Q8UUW7	1.19e-114	341	433	0.573	0.462	KHDR1_CHICK KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Gallus gallus OX=9031 GN=KHDRBS1 PE=2 SV=1
11	E5RJZ9	3.99e-107	316	265	0.513	0.675	E5RJZ9_HUMAN KH RNA binding domain containing, signal transduction associated 3 (Fragment) OS=Homo sapiens OX=9606 GN=KHDRBS3 PE=1 SV=1
12	Q6NW56	1.10e-85	265	370	0.490	0.462	Q6NW56_DANRE KH domain containing, RNA binding, signal transduction associated 1 OS=Danio rerio OX=7955 GN=khdrbs1 PE=1 SV=1
13	A2CE73	6.21e-84	260	369	0.490	0.463	A2CE73_DANRE KH domain containing, RNA binding, signal transduction associated 1a isoform X1 OS=Danio rerio OX=7955 GN=fj90g10 PE=1 SV=1
14	Q6NW62	2.06e-82	256	352	0.352	0.349	Q6NW62_DANRE KH domain-containing, RNA-binding, signal transduction-associated 1b OS=Danio rerio OX=7955 GN=sb:cb97 PE=1 SV=1
15	Q7KNS5	8.30e-61	202	428	0.358	0.292	Q7KNS5_DROME Quaking related 54B, isoform A OS=Drosophila melanogaster OX=7227 GN=qkr54B PE=1 SV=1
16	H0YAQ1	9.16e-60	192	195	0.347	0.621	H0YAQ1_HUMAN KH RNA binding domain containing, signal transduction associated 3 (Fragment) OS=Homo sapiens OX=9606 GN=KHDRBS3 PE=1 SV=1
17	A0A0B4KFT9	1.36e-59	204	617	0.358	0.203	A0A0B4KFT9_DROME Quaking related 54B, isoform E OS=Drosophila melanogaster OX=7227 GN=qkr54B PE=1 SV=1
18	O44433	1.86e-59	199	425	0.350	0.287	O44433_DROME QKR54B OS=Drosophila melanogaster OX=7227 GN=qkr54B PE=2 SV=1
19	A0A0B4LG88	5.05e-56	189	379	0.266	0.245	A0A0B4LG88_DROME Quaking related 58E-1, isoform D OS=Drosophila melanogaster OX=7227 GN=qkr58E-1 PE=1 SV=1
20	Q9W255	7.61e-56	189	396	0.266	0.235	Q9W255_DROME GH05812p OS=Drosophila melanogaster OX=7227 GN=qkr58E-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00013 KH_1	1.6e-05	35.9	KH domain
2	PF16274 Qua1	1.1e-24	97.3	Qua1 domain
3	PF16568 Sam68-YY	2.8e-18	77.7	Tyrosine-rich domain of Sam68
4	PF16544 STAR_dimer	2.7	18.9	Homodimerisation region of STAR domain protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281156

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000442460	0.951	Protein-tyrosine kinase 6
2	9606.ENSP00000359645	0.863	RNA-binding motif protein, X chromosome
3	9606.ENSP00000365950	0.841	RNA-binding protein 3
4	9606.ENSP00000365439	0.818	Heterogeneous nuclear ribonucleoprotein K
5	9606.ENSP00000348108	0.753	KH domain-containing, RNA-binding, signal transduction-associated protein 3
6	9606.ENSP00000273666	0.744	Syntaxin-binding protein 5-like
7	9606.ENSP00000357304	0.738	Protein BLOM7
8	9606.ENSP00000339245	0.713	YTH domain-containing protein 1
9	9606.ENSP00000406162	0.712	Protein arginine N-methyltransferase 1
10	9606.ENSP00000431885	0.673	Non-receptor tyrosine-protein kinase TYK2
11	9606.ENSP00000318177	0.655	Far upstream element-binding protein 3
12	9606.ENSP00000418563	0.632	U2 snRNP-associated SURP motif-containing protein
13	9606.ENSP00000307863	0.631	Splicing factor U2AF 65 kDa subunit
14	9606.ENSP00000359691	0.625	Lengsin
15	9606.ENSP00000298248	0.610	Lambda-crystallin homolog
16	9606.ENSP00000368341	0.609	RNA-binding protein 24
17	9606.ENSP00000381216	0.581	Far upstream element-binding protein 2
18	9606.ENSP00000466897	0.576	Cold-inducible RNA-binding protein
19	9606.ENSP00000421258	0.561	Zinc finger protein 154
20	9606.ENSP00000363745	0.554	Heterogeneous nuclear ribonucleoprotein R

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0042802	0.546	identical protein binding
GO:0003729	0.486	mRNA binding
GO:0003727	0.407	single-stranded RNA binding
GO:0019904	0.331	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0043484	0.987	regulation of RNA splicing
GO:1903311	0.981	regulation of mRNA metabolic process
GO:0050684	0.956	regulation of mRNA processing
GO:0048024	0.946	regulation of mRNA splicing, via spliceosome
GO:0009987	0.932	cellular process
GO:0071704	0.503	organic substance metabolic process
GO:0044238	0.409	primary metabolic process
GO:0044237	0.406	cellular metabolic process
GO:0006807	0.389	nitrogen compound metabolic process
GO:0043170	0.388	macromolecule metabolic process
GO:1901360	0.316	organic cyclic compound metabolic process
GO:0034641	0.311	cellular nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.680	cytoplasm
GO:0032991	0.482	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]