StarFunc result for job id Q5VWZ2

User Input

>input (237 residues)
MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPT
APPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILI
GGFSMGGCMAIHLAYRNHQDVAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADE
LVLHSWAEETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLPGEMEKQK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VWZ2	1.000	1.000	1.351E-51	237	1.000	1.000	Q5VWZ2.pdb.gz	LYPL1_HUMAN Lysophospholipase-like protein 1 OS=Homo sapiens OX=9606 GN=LYPLAL1 PE=1 SV=3
2	PDB:5kreA	0.944	0.999	1.447E-47	224	0.941	0.996	5kreA.pdb.gz	Discovery of a Selective Covalent Inhibitor of Lysophospholipase-like 1 (LYPLAL1) as a Tool to Evaluate the Role of this Serine Hydrolase in Metabolism.
3	AFDB:Q3UFF7	0.972	0.964	1.652E-42	239	0.764	0.757	Q3UFF7.pdb.gz	LYPL1_MOUSE Lysophospholipase-like protein 1 OS=Mus musculus OX=10090 GN=Lyplal1 PE=1 SV=3
4	AFDB:Q9VGV9	0.946	0.953	1.025E-31	235	0.426	0.430	Q9VGV9.pdb.gz	Q9VGV9_DROME palmitoyl-protein hydrolase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6567 PE=1 SV=1
5	AFDB:O42881	0.832	0.878	7.895E-22	224	0.270	0.286	O42881.pdb.gz	APTH1_SCHPO Acyl-protein thioesterase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC8E11.04c PE=3 SV=1
6	PDB:5synA	0.845	0.895	9.619E-22	223	0.308	0.327	5synA.pdb.gz	Molecular Mechanism for Isoform-Selective Inhibition of Acyl Protein Thioesterases 1 and 2 (APT1 and APT2).
7	AFDB:O75608	0.829	0.853	5.981E-21	230	0.312	0.322	O75608.pdb.gz	LYPA1_HUMAN Acyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=LYPLA1 PE=1 SV=1
8	AFDB:Q55FK4	0.847	0.901	7.190E-21	222	0.253	0.270	Q55FK4.pdb.gz	APT12_DICDI Acyl-protein thioesterase 1 homolog 2 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0268064 PE=1 SV=1
9	AFDB:M9PEW1	0.829	0.846	1.039E-20	232	0.278	0.284	M9PEW1.pdb.gz	M9PEW1_DROME palmitoyl-protein hydrolase OS=Drosophila melanogaster OX=7227 GN=Apt1 PE=1 SV=1
10	PDB:1fj2A	0.835	0.863	3.820E-20	229	0.312	0.323	1fj2A.pdb.gz
11	AFDB:O95372	0.827	0.848	5.446E-20	231	0.300	0.307	O95372.pdb.gz	LYPA2_HUMAN Acyl-protein thioesterase 2 OS=Homo sapiens OX=9606 GN=LYPLA2 PE=1 SV=1
12	AFDB:Q8L9X1	0.785	0.740	8.616E-19	252	0.266	0.250	Q8L9X1.pdb.gz	Q8L9X1_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g20060 PE=1 SV=1
13	AFDB:Q12354	0.813	0.847	1.101E-18	227	0.241	0.251	Q12354.pdb.gz	APTH1_YEAST Acyl-protein thioesterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLR118C PE=1 SV=1
14	PDB:6avvA	0.751	0.842	1.512E-16	210	0.224	0.252	6avvA.pdb.gz
15	PDB:1ycdB	0.548	0.546	1.064E-7	238	0.143	0.143	1ycdB.pdb.gz	Crystal structure of yeast YHR049W/FSH1, a member of the serine hydrolase family.
16	PDB:6eorB	0.529	0.182	1.360E-7	805	0.177	0.052	6eorB.pdb.gz	Structures and mechanism of dipeptidyl peptidases 8 and 9, important players in cellular homeostasis and cancer.
17	PDB:6y0fC	0.569	0.208	1.849E-7	722	0.148	0.048	6y0fC.pdb.gz	Structure of human FAPalpha in complex with linagliptin
18	PDB:3fcxB	0.620	0.544	4.105E-7	275	0.148	0.127	3fcxB.pdb.gz	Crystal structure of human esterase D: a potential genetic marker of retinoblastoma
19	PDB:2gbfA	0.605	0.217	4.641E-7	730	0.135	0.044	2gbfA.pdb.gz	Crystal Structures of DPP-IV (CD26) from Rat Kidney Exhibit Flexible Accommodation of Peptidase-Selective Inhibitors.
20	PDB:7jn7A	0.510	0.165	5.579E-7	846	0.169	0.047	7jn7A.pdb.gz	Dipeptidyl peptidase 9 sets a threshold for CARD8 inflammasome formation by sequestering its active C-terminal fragment.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5VWZ2	2.24e-180	495	237	1.000	1.000	LYPL1_HUMAN Lysophospholipase-like protein 1 OS=Homo sapiens OX=9606 GN=LYPLAL1 PE=1 SV=3
2	Q3UFF7	6.43e-136	383	239	0.768	0.762	LYPL1_MOUSE Lysophospholipase-like protein 1 OS=Mus musculus OX=10090 GN=Lyplal1 PE=1 SV=3
3	Q9VGV9	1.25e-64	202	235	0.435	0.438	Q9VGV9_DROME palmitoyl-protein hydrolase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6567 PE=1 SV=1
4	O95372	1.73e-28	109	231	0.304	0.312	LYPA2_HUMAN Acyl-protein thioesterase 2 OS=Homo sapiens OX=9606 GN=LYPLA2 PE=1 SV=1
5	O75608	5.25e-28	108	230	0.312	0.322	LYPA1_HUMAN Acyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=LYPLA1 PE=1 SV=1
6	Q6IAQ1	5.25e-28	108	230	0.312	0.322	Q6IAQ1_HUMAN palmitoyl-protein hydrolase OS=Homo sapiens OX=9606 GN=LYPLA1 PE=1 SV=1
7	P70470	8.36e-28	107	230	0.316	0.326	LYPA1_RAT Acyl-protein thioesterase 1 OS=Rattus norvegicus OX=10116 GN=Lypla1 PE=1 SV=1
8	Q9WTL7	3.01e-27	106	231	0.295	0.303	LYPA2_MOUSE Acyl-protein thioesterase 2 OS=Mus musculus OX=10090 GN=Lypla2 PE=1 SV=1
9	P97823	6.30e-27	105	230	0.316	0.326	LYPA1_MOUSE Acyl-protein thioesterase 1 OS=Mus musculus OX=10090 GN=Lypla1 PE=1 SV=1
10	Q9I7R0	2.09e-26	103	216	0.291	0.319	Q9I7R0_DROME palmitoyl-protein hydrolase OS=Drosophila melanogaster OX=7227 GN=Apt1 PE=1 SV=1
11	C0PDF4	2.21e-26	103	221	0.291	0.312	C0PDF4_DROME palmitoyl-protein hydrolase OS=Drosophila melanogaster OX=7227 GN=Apt1 PE=1 SV=1
12	M9PEW1	2.44e-26	103	232	0.291	0.297	M9PEW1_DROME palmitoyl-protein hydrolase OS=Drosophila melanogaster OX=7227 GN=Apt1 PE=1 SV=1
13	O42881	4.78e-22	92.4	224	0.257	0.272	APTH1_SCHPO Acyl-protein thioesterase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC8E11.04c PE=3 SV=1
14	Q8L9X1	5.46e-22	92.8	252	0.316	0.298	Q8L9X1_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g20060 PE=1 SV=1
15	Q55FK4	8.49e-22	91.7	222	0.253	0.270	APT12_DICDI Acyl-protein thioesterase 1 homolog 2 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0268064 PE=1 SV=1
16	Q8GYK2	2.39e-19	86.3	262	0.228	0.206	SOBRL_ARATH Probable carboxylesterase SOBER1-like OS=Arabidopsis thaliana OX=3702 GN=At4g22300 PE=2 SV=1
17	Q84WK4	3.37e-18	82.4	228	0.241	0.250	SOBR1_ARATH Carboxylesterase SOBER1 OS=Arabidopsis thaliana OX=3702 GN=SOBER1 PE=1 SV=1
18	F4J010	1.20e-16	79.0	274	0.262	0.226	F4J010_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g15650 PE=1 SV=1
19	Q12354	1.52e-15	75.1	227	0.241	0.251	APTH1_YEAST Acyl-protein thioesterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLR118C PE=1 SV=1
20	D6XM23	2.96e-15	75.1	280	0.274	0.232	D6XM23_TRYB2 Lysophospholipase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.160 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00561 Abhydrolase_1	1.3	20.2	alpha/beta hydrolase fold
2	PF20408 Abhydrolase_11	0.18	23.0	Alpha/beta hydrolase domain
3	PF02230 Abhydrolase_2	9.7e-39	145.0	Phospholipase/Carboxylesterase
4	PF07859 Abhydrolase_3	0.0021	29.5	alpha/beta hydrolase fold
5	PF12695 Abhydrolase_5	0.24	22.6	Alpha/beta hydrolase family
6	PF12697 Abhydrolase_6	20	17.3	Alpha/beta hydrolase family
7	PF20434 BD-FAE	1.5e+02	13.3	BD-FAE
8	PF01738 DLH	0.0016	29.6	Dienelactone hydrolase family
9	PF00756 Esterase	0.025	25.8	Putative esterase
10	PF03959 FSH1	1.5	20.0	Serine hydrolase (FSH1)
11	PF12146 Hydrolase_4	0.00025	31.9	Serine aminopeptidase, S33
12	PF01764 Lipase_3	1.2e+02	13.9	Lipase (class 3)
13	PF00326 Peptidase_S9	0.43	21.6	Prolyl oligopeptidase family
14	PF07819 PGAP1	3.3e+02	12.4	PGAP1-like protein
15	PF00975 Thioesterase	2.3e+02	13.3	Thioesterase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355895

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308318	0.811	Protein phosphatase 1 regulatory subunit 3B
2	9606.ENSP00000345445	0.811	Sorting and assembly machinery component 50 homolog
3	9606.ENSP00000264717	0.781	Glucokinase regulatory protein
4	9606.ENSP00000216180	0.764	Patatin-like phospholipase domain-containing protein 3
5	9606.ENSP00000252575	0.739	Neurocan core protein
6	9606.ENSP00000250974	0.726	Protein ABHD17A
7	9606.ENSP00000374014	0.716	Transmembrane 6 superfamily member 2
8	9606.ENSP00000313921	0.702	Mitochondrial peptide methionine sulfoxide reductase
9	9606.ENSP00000263915	0.659	Growth factor receptor-bound protein 14
10	9606.ENSP00000327323	0.656	Threonine synthase-like 2
11	9606.ENSP00000295448	0.626	Glucosamine-6-phosphate deaminase 2
12	9606.ENSP00000341360	0.612	Cordon-bleu WH2 repeat protein like 1
13	9606.ENSP00000451648	0.606	Neurexin-3
14	9606.ENSP00000281017	0.604	Transmembrane protein 18
15	9606.ENSP00000377265	0.603	Transcription factor AP-2-beta
16	9606.ENSP00000418823	0.602	Alpha-ketoglutarate-dependent dioxygenase FTO
17	9606.ENSP00000433427	0.602	ADP-ribosylation factor-like protein 15
18	9606.ENSP00000295119	0.601	Nucleoporin NUP53
19	9606.ENSP00000394390	0.601	BTB/POZ domain-containing protein KCTD15
20	9606.ENSP00000480828	0.600	Squalene synthase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.999	catalytic activity
GO:0016787	0.983	hydrolase activity
GO:0016788	0.933	hydrolase activity, acting on ester bonds
GO:0052689	0.607	carboxylic ester hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.997	metabolic process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.987	primary metabolic process
GO:0050789	0.978	regulation of biological process
GO:0042157	0.972	lipoprotein metabolic process
GO:0048519	0.967	negative regulation of biological process
GO:0050794	0.958	regulation of cellular process
GO:0043412	0.938	macromolecule modification
GO:0036211	0.933	protein modification process
GO:1901565	0.926	organonitrogen compound catabolic process
GO:0032879	0.924	regulation of localization
GO:0035601	0.919	protein deacylation
GO:0048523	0.907	negative regulation of cellular process
GO:0009057	0.880	macromolecule catabolic process
GO:0051049	0.857	regulation of transport
GO:0060341	0.803	regulation of cellular localization
GO:0009987	0.773	cellular process
GO:0032880	0.734	regulation of protein localization
GO:1903828	0.724	negative regulation of protein localization
GO:1904375	0.601	regulation of protein localization to cell periphery
GO:1905475	0.492	regulation of protein localization to membrane
GO:0044237	0.465	cellular metabolic process
GO:0051223	0.415	regulation of protein transport
GO:0030163	0.369	protein catabolic process
GO:1904950	0.357	negative regulation of establishment of protein localization
GO:0051224	0.354	negative regulation of protein transport
GO:1903076	0.345	regulation of protein localization to plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.302	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.983	Hydrolases.
EC:3.1.-.-	0.933	Acting on ester bonds.
EC:3.1.1.-	0.607	Carboxylic ester hydrolases.

[back to server]