StarFunc result for job id Q5VX71

User Input

>input (490 residues)
MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQVCADP
GIPENGFRTPSGGVFFEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDNSICVQE
DCRIPQIEDAEIHNKTYRHGEKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGC
LRPLASSNGYVNISELQTSFPVGTVISYRCFPGFKLDGSAYLECLQNLIWSSSPPRCLAL
EVCPLPPMVSHGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQV
YCIKSEQTWPSTHETLLTTWKIVAFTATSVLLVLLLVILARMFQTKFKAHFPPRGPPRSS
SSDPDFVVVDGVPVMLPSYDEAVSGGLSALGPGYMASVGQGCPLPVDDQSPPAYPGSGDT
DTGPGESETCDSVSGSSELLQSLYSPPRCQESTHPASDNPDIIASTAEEVASTSPGIDIA
DEIPLMEEDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VX71	1.000	1.000	2.836E-84	490	1.000	1.000	Q5VX71.pdb.gz	SUSD4_HUMAN Sushi domain-containing protein 4 OS=Homo sapiens OX=9606 GN=SUSD4 PE=1 SV=1
2	PDB:2gsxA	0.168	0.098	3.616E-18	951	0.139	0.072	2gsxA.pdb.gz
3	PDB:1c1zA	0.210	0.297	1.315E-15	326	0.108	0.163	1c1zA.pdb.gz
4	PDB:2q7zA	0.136	0.055	2.136E-14	1931	0.131	0.033	2q7zA.pdb.gz
5	AFDB:Q92537	0.161	0.249	1.979E-12	303	0.182	0.294	Q92537.pdb.gz	SUSD6_HUMAN Sushi domain-containing protein 6 OS=Homo sapiens OX=9606 GN=SUSD6 PE=1 SV=1
6	PDB:1haqA	0.183	0.092	1.328E-11	1213	0.135	0.054	1haqA.pdb.gz
7	PDB:8a7eC	0.238	0.102	1.646E-11	1524	0.110	0.035	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
8	PDB:2xwbF	0.160	0.116	8.240E-10	714	0.078	0.053	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
9	PDB:8a7dQ	0.130	0.212	4.581E-9	273	0.086	0.154	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
10	PDB:3t5oA	0.171	0.106	9.218E-8	871	0.067	0.038	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
11	PDB:4e0sB	0.139	0.082	1.342E-7	898	0.088	0.048	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
12	PDB:7nycC	0.173	0.115	2.179E-6	809	0.073	0.044	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
13	AFDB:A0A140LGI0	0.107	0.055	2.130E-4	1176	0.139	0.058	A0A140LGI0.pdb.gz
14	AFDB:P01132	0.109	0.051	6.927E-4	1217	0.157	0.063	P01132.pdb.gz	EGF_MOUSE Pro-epidermal growth factor OS=Mus musculus OX=10090 GN=Egf PE=1 SV=2
15	AFDB:O19131	0.124	0.128	6.944E-3	471	0.120	0.125	O19131.pdb.gz	TNR1A_BOVIN Tumor necrosis factor receptor superfamily member 1A OS=Bos taurus OX=9913 GN=TNFRSF1A PE=2 SV=1
16	AFDB:Q08180	0.099	0.071	8.155E-3	764	0.118	0.076	Q08180.pdb.gz	ICCR_DROME Irregular chiasm C-roughest protein OS=Drosophila melanogaster OX=7227 GN=rst PE=1 SV=2
17	AFDB:A1Z9X4	0.084	0.041	1.321E-2	1235	0.127	0.050	A1Z9X4.pdb.gz	A1Z9X4_DROME Hibris, isoform B OS=Drosophila melanogaster OX=7227 GN=hbs PE=4 SV=1
18	AFDB:A8Y5W0	0.106	0.075	1.727E-2	810	0.102	0.062	A8Y5W0.pdb.gz	A8Y5W0_DANRE Granulocyte colony-stimulating factor receptor OS=Danio rerio OX=7955 GN=gcsfr PE=2 SV=1
19	AFDB:Q99062	0.084	0.057	2.140E-2	836	0.137	0.080	Q99062.pdb.gz	CSF3R_HUMAN Granulocyte colony-stimulating factor receptor OS=Homo sapiens OX=9606 GN=CSF3R PE=1 SV=1
20	AFDB:Q91XX9	0.093	0.063	4.072E-2	932	0.137	0.072	Q91XX9.pdb.gz	Q91XX9_MOUSE Protocadherin gamma A9 OS=Mus musculus OX=10090 GN=Pcdhga9 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5VX71	0.0	1012	490	1.000	1.000	SUSD4_HUMAN Sushi domain-containing protein 4 OS=Homo sapiens OX=9606 GN=SUSD4 PE=1 SV=1
2	E7FEC4	7.02e-173	497	484	0.514	0.521	SUSD4_DANRE Sushi domain-containing protein 4 OS=Danio rerio OX=7955 GN=susd4 PE=3 SV=1
3	Q92537	4.74e-25	107	303	0.167	0.271	SUSD6_HUMAN Sushi domain-containing protein 6 OS=Homo sapiens OX=9606 GN=SUSD6 PE=1 SV=1
4	A2AVA0	1.12e-17	89.0	3567	0.153	0.021	SVEP1_MOUSE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Svep1 PE=1 SV=1
5	A0A1D5NSM8	2.23e-17	88.2	3615	0.127	0.017	A0A1D5NSM8_DANRE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing 1 OS=Danio rerio OX=7955 GN=svep1 PE=4 SV=1
6	Q4LDE5	7.44e-17	86.7	3571	0.163	0.022	SVEP1_HUMAN Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SVEP1 PE=1 SV=3
7	Q80T79	3.24e-15	81.3	3707	0.153	0.020	CSMD3_MOUSE CUB and sushi domain-containing protein 3 OS=Mus musculus OX=10090 GN=Csmd3 PE=1 SV=3
8	Q07968	4.50e-15	80.1	669	0.147	0.108	F13B_MOUSE Coagulation factor XIII B chain OS=Mus musculus OX=10090 GN=F13b PE=1 SV=2
9	P05160	1.11e-14	79.0	661	0.143	0.106	F13B_HUMAN Coagulation factor XIII B chain OS=Homo sapiens OX=9606 GN=F13B PE=1 SV=3
10	Q923L3	1.56e-14	79.3	3564	0.137	0.019	CSMD1_MOUSE CUB and sushi domain-containing protein 1 OS=Mus musculus OX=10090 GN=Csmd1 PE=1 SV=2
11	Q5XJW6	3.12e-14	77.8	689	0.133	0.094	Q5XJW6_RAT Cfh protein OS=Rattus norvegicus OX=10116 GN=Cfh PE=1 SV=1
12	Q91YB6	4.49e-14	77.4	1236	0.127	0.050	Q91YB6_RAT Complement inhibitory factor H OS=Rattus norvegicus OX=10116 GN=Cfh PE=2 SV=1
13	G3V9R2	4.81e-14	77.4	1235	0.127	0.050	G3V9R2_RAT Complement factor H OS=Rattus norvegicus OX=10116 GN=Cfh PE=4 SV=1
14	P16109	3.60e-13	74.3	830	0.124	0.073	LYAM3_HUMAN P-selectin OS=Homo sapiens OX=9606 GN=SELP PE=1 SV=3
15	D3Z9F7	9.59e-13	73.2	1406	0.133	0.046	D3Z9F7_RAT Complement C3d receptor 2 OS=Rattus norvegicus OX=10116 GN=Cr2 PE=4 SV=3
16	Q96PZ7	1.33e-12	73.2	3564	0.143	0.020	CSMD1_HUMAN CUB and sushi domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CSMD1 PE=1 SV=3
17	P06909	1.73e-12	72.4	1234	0.122	0.049	CFAH_MOUSE Complement factor H OS=Mus musculus OX=10090 GN=Cfh PE=1 SV=2
18	Q92496	2.58e-12	71.2	578	0.143	0.121	FHR4_HUMAN Complement factor H-related protein 4 OS=Homo sapiens OX=9606 GN=CFHR4 PE=1 SV=3
19	A8JUT1	5.29e-12	70.5	755	0.120	0.078	A8JUT1_DROME Furrowed, isoform B OS=Drosophila melanogaster OX=7227 GN=fw PE=4 SV=1
20	Q9VYR4	5.63e-12	70.9	1174	0.120	0.050	Q9VYR4_DROME Furrowed, isoform A OS=Drosophila melanogaster OX=7227 GN=fw PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03427 CBM_19	5.3e+02	12.0	Carbohydrate binding domain (family 19)
2	PF02793 HRM	1.1e+02	14.5	Hormone receptor domain
3	PF03454 MoeA_C	6e+02	12.0	MoeA C-terminal region (domain IV)
4	PF00084 Sushi	9.9e-33	123.7	Sushi repeat (SCR repeat)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344219

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261211	0.693	Cyclin-dependent kinase 17
2	9606.ENSP00000481096	0.690	Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C
3	9606.ENSP00000386022	0.624	Membrane-spanning 4-domains subfamily A member 15
4	9606.ENSP00000386389	0.557	Kelch-like protein 30
5	9606.ENSP00000322343	0.524	Cyclin-dependent kinase 20
6	9606.ENSP00000355480	0.523	EF-hand calcium-binding domain-containing protein 2
7	9606.ENSP00000373370	0.519	Filaggrin-2
8	9606.ENSP00000483599	0.518	Spondin-2
9	9606.ENSP00000265634	0.514	Neuronal pentraxin-2
10	9606.ENSP00000229771	0.504	Tubby-related protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.982	regulation of biological process
GO:0048583	0.919	regulation of response to stimulus
GO:0002920	0.899	regulation of humoral immune response
GO:0002697	0.896	regulation of immune effector process
GO:0048519	0.892	negative regulation of biological process
GO:0030449	0.851	regulation of complement activation
GO:0002706	0.850	regulation of lymphocyte mediated immunity
GO:0050777	0.848	negative regulation of immune response
GO:0002921	0.802	negative regulation of humoral immune response
GO:0002698	0.794	negative regulation of immune effector process
GO:0031348	0.764	negative regulation of defense response
GO:0002832	0.763	negative regulation of response to biotic stimulus
GO:0032101	0.750	regulation of response to external stimulus
GO:0002822	0.741	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0032102	0.657	negative regulation of response to external stimulus
GO:0002889	0.622	regulation of immunoglobulin mediated immune response
GO:0002704	0.606	negative regulation of leukocyte mediated immunity
GO:0045824	0.602	negative regulation of innate immune response
GO:0002707	0.591	negative regulation of lymphocyte mediated immunity
GO:0002820	0.568	negative regulation of adaptive immune response
GO:0002823	0.537	negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0009987	0.487	cellular process
GO:0050794	0.377	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.996	intracellular anatomical structure
GO:0043227	0.996	membrane-bounded organelle
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0016020	0.985	membrane
GO:0012505	0.978	endomembrane system
GO:0031982	0.978	vesicle
GO:0005737	0.965	cytoplasm
GO:0071944	0.885	cell periphery
GO:0005886	0.782	plasma membrane
GO:0005576	0.740	extracellular region
GO:0005615	0.465	extracellular space
GO:0031410	0.309	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]