StarFunc result for job id Q5VXU9

User Input

>input (1444 residues)
MTDTSVLDQWKASFFVEDFLEKKTITRMVTQINCEFEEVVPSSNPDSQIEVEEVSLYTHM
DYNEVFTPVSCLEKCSALQNQNQDLFIDDKGILFVSSRKHLPTLPTLLSRLKLFLVKDPL
LDFKGQIFTEANFSRECFSLQETLEAFVKEDFCMDKVNFCQEKLEDTICLNEPSSFLIEY
EFLIPPSLKPEIDIPSLSELKELLNPVPEIINYVDEKEKLFERDLTNKHGIEDIGDIKFS
STEILTIQSQSEPEECSKPGELEMPLTPLFLTCQHSSVNSLRTELQTFPLSPVCKINLLT
AEESANEYYMMWQLERCRSPLNPFLLTVPRIQEPHSQYSVTDLKKIFSVKEESLVINLEK
AEWWKQAGLNLKMMETLEHLNTYLCHDNLSSNDTKIEIFLPTKVLQLESCLEHKSHSSPI
ALIDEKSTNAHLSLPQKSPSLAKEVPDLCFSDDYFSDKGAAKEEKPKNDQEPVNRIIQKK
ENNDHFELDCTGPSIKSPSSSIIKKASFEHGKKQENDLDLLSDFIMLRNKYKTCTSKTEV
TNSDEKHDKEACSLTLQEESPIVHINKTLEEINQERGTDSVIEIQASDSQCQAFCLLEAA
ASPILKNLVSLCTLPTANWKFATVIFDQTRFLLKEQEKVVSDAVRQGTIDEREMTFKHAA
LLHLLVTIRDVLLTCSLDTALGYLSKAKDIYNSILGPYLGDIWRQLEIVQFIRGKKPETN
YKIQELQCQILSWMQSQQQIKVLIIIRMDSDGEKHFLIKILNKIEGLTLTVLHSNERKDF
LESEGVLRGTSSCVVVHNQYIGADFPWSNFSFVVEYNYVEDSCWTKHCKELNIPYMAFKV
ILPDTVLERSTLLDRFGGFLLEIQIPYVFFASEGLLNTPDILQLLESNYNISLVERGCSE
SLKLFGSSECYVVVTIDEHTAIILQDLEELNYEKASDNIIMRLMALSLQYRYCWIILYTK
ETLNSEYLLTEKTLHHLALIYAALVSFGLNSEELDVKLIIAPGVEATALIIRQIADHSLM
TSKRDPHEWLDKSWLKVSPSEEEMYLLDFPCINPLVAQLMLNKGPSLHWILLATLCQLQE
LLPEVPEKVLKHFCSITSLFKIGSSSITKSPQISSPQENRNQISTLSSQSSASDLDSVIQ
EHNEYYQYLGLGETVQEDKTTILNDNSSIMELKEISSFLPPVTSYNQTSYWKDSSCKSNI
GQNTPFLINIESRRPAYNSFLNHSDSESDVFSLGLTQMNCETIKSPTDTQKRVSVVPRFI
NSQKRRTHEAKGFINKDVSDPIFSLEGTQSPLHWNFKKNIWEQENHPFNLQYGAQQTACN
KLYSQKGNLFTDQQKCLSDESEGLTCESSKDETFWRELPSVPSLDLFRASDSNANQKEFN
SLYFYQRAGKSLGQKRHHESSFNSGDKESLTGFMCSQLPQFKKRRLAYEKVPGRVDGQTR
LRFF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VXU9	1.000	1.000	0.000	1444	1.000	1.000	Q5VXU9.pdb.gz	SHOC1_HUMAN Protein shortage in chiasmata 1 ortholog OS=Homo sapiens OX=9606 GN=SHOC1 PE=1 SV=1
2	PDB:6sxaF	0.125	0.222	1.367E-8	747	0.055	0.107	6sxaF.pdb.gz
3	PDB:6sxbF	0.125	0.232	7.581E-8	701	0.055	0.114	6sxbF.pdb.gz	Cryo-EM structures of the XPF-ERCC1 endonuclease reveal how DNA-junction engagement disrupts an auto-inhibited conformation.
4	AFDB:F4IZM8	0.044	0.046	1.296E-6	1347	0.134	0.143	F4IZM8.pdb.gz	HUAL3_ARATH Protein HUA2-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=HULK3 PE=2 SV=1
5	AFDB:Q4GYI9	0.050	0.046	2.495E-6	1737	0.124	0.103	Q4GYI9.pdb.gz	Q4GYI9_TRYB2 Fusaric acid resistance protein-like OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3880 PE=4 SV=1
6	AFDB:Q9UIF8	0.042	0.033	3.986E-5	2168	0.141	0.094	Q9UIF8.pdb.gz	BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens OX=9606 GN=BAZ2B PE=1 SV=3
7	AFDB:F4IN78	0.053	0.056	4.191E-5	1366	0.121	0.128	F4IN78.pdb.gz	HUAL2_ARATH Protein HUA2-LIKE 2 OS=Arabidopsis thaliana OX=3702 GN=HULK2 PE=2 SV=2
8	AFDB:Q57WC1	0.054	0.053	6.596E-5	1387	0.119	0.124	Q57WC1.pdb.gz	Q57WC1_TRYB2 Ancestral coatomer element 1 Sec16/Sec31 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.610 PE=3 SV=1
9	PDB:4bxoB	0.077	0.446	8.769E-5	196	0.018	0.133	4bxoB.pdb.gz	Architecture and DNA Recognition Elements of the Fanconi Anemia Fancm-Faap24 Complex.
10	AFDB:Q9VUQ9	0.080	0.064	1.477E-4	2139	0.120	0.081	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
11	AFDB:E7F1U2	0.061	0.056	5.204E-4	1673	0.125	0.108	E7F1U2.pdb.gz	DNMBP_DANRE Dynamin-binding protein OS=Danio rerio OX=7955 GN=dnmbp PE=2 SV=1
12	AFDB:Q09811	0.080	0.086	5.204E-4	1328	0.121	0.132	Q09811.pdb.gz	HUS2_SCHPO ATP-dependent DNA helicase hus2/rqh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rqh1 PE=1 SV=1
13	AFDB:X2JAX8	0.042	0.045	5.756E-4	1330	0.117	0.127	X2JAX8.pdb.gz	X2JAX8_DROME Nostrin, isoform H OS=Drosophila melanogaster OX=7227 GN=Nost PE=1 SV=1
14	PDB:8dvsA	0.135	0.255	6.255E-4	682	0.030	0.065	8dvsA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
15	PDB:4a2wA	0.110	0.200	3.648E-3	678	0.028	0.060	4a2wA.pdb.gz
16	PDB:6acaA	0.068	0.085	4.936E-3	1133	0.037	0.048	6acaA.pdb.gz
17	PDB:5weaA	0.044	0.076	6.678E-3	764	0.024	0.045	5weaA.pdb.gz	Helix-7 in Argonaute2 shapes the microRNA seed region for rapid target recognition.
18	PDB:6igmH	0.074	0.249	1.051E-2	373	0.013	0.051	6igmH.pdb.gz
19	PDB:6h61A	0.134	0.260	1.573E-2	660	0.026	0.058	6h61A.pdb.gz	Cryo-EM Structures of MDA5-dsRNA Filaments at Different Stages of ATP Hydrolysis.
20	PDB:6oonA	0.043	0.070	2.237E-2	785	0.023	0.042	6oonA.pdb.gz	Multidomain Convergence of Argonaute during RISC Assembly Correlates with the Formation of Internal Water Clusters.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2ALV5	0.0	1555	1481	0.593	0.578	SHOC1_MOUSE Protein shortage in chiasmata 1 ortholog OS=Mus musculus OX=10090 GN=Shoc1 PE=1 SV=1
2	Q5VXU9	0.0	2967	1444	1.000	1.000	SHOC1_HUMAN Protein shortage in chiasmata 1 ortholog OS=Homo sapiens OX=9606 GN=SHOC1 PE=1 SV=1
3	P12938	0.23	38.1	500	0.021	0.062	CP2D3_RAT Cytochrome P450 2D3 OS=Rattus norvegicus OX=10116 GN=Cyp2d3 PE=2 SV=2
4	A0A0J9X1Q5	2.3	35.0	853	0.014	0.023	PIGE_SERSF Aminotransferase PigE OS=Serratia sp. (strain FS14) OX=1327989 GN=pigE PE=1 SV=1
5	Q86II4	4.3	33.9	362	0.024	0.097	TPS3_DICDI Terpene synthase 3 OS=Dictyostelium discoideum OX=44689 GN=TPS3 PE=1 SV=1
6	Q8MSX1	5.0	34.3	1818	0.010	0.008	ENC_DROME Protein encore OS=Drosophila melanogaster OX=7227 GN=enc PE=1 SV=2
7	Q5W267	5.1	33.9	853	0.013	0.022	PIGE_SERS3 Aminotransferase PigE OS=Serratia sp. (strain ATCC 39006) OX=104623 GN=pigE PE=1 SV=1
8	Q9VAP8	5.1	33.9	685	0.013	0.028	Q9VAP8_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=alpha-Man-Ib PE=1 SV=1
9	P9WLV5	7.4	33.1	346	0.009	0.038	Y1520_MYCTU Uncharacterized protein Rv1520 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1520 PE=1 SV=1
10	P35538	8.1	33.1	360	0.022	0.089	FLHB_BACSU Flagellar biosynthetic protein FlhB OS=Bacillus subtilis (strain 168) OX=224308 GN=flhB PE=3 SV=2
11	Q99MV1	9.8	33.1	1172	0.037	0.046	TDRD1_MOUSE Tudor domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tdrd1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17825 DUF5587	0	2941.8	Family of unknown function (DUF5587)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363405

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379226	0.668	Testis-expressed protein 11
2	9606.ENSP00000466121	0.568	Fanconi anemia core complex-associated protein 24
3	9606.ENSP00000263187	0.560	MutS protein homolog 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003697	1.000	single-stranded DNA binding
GO:0016887	1.000	ATP hydrolysis activity
GO:0005515	0.557	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0006807	0.993	nitrogen compound metabolic process
GO:0044238	0.983	primary metabolic process
GO:0043170	0.981	macromolecule metabolic process
GO:0034641	0.980	cellular nitrogen compound metabolic process
GO:1901360	0.968	organic cyclic compound metabolic process
GO:0046483	0.968	heterocycle metabolic process
GO:0006725	0.968	cellular aromatic compound metabolic process
GO:0045132	0.968	meiotic chromosome segregation
GO:0007127	0.965	meiosis I
GO:0007131	0.964	reciprocal meiotic recombination
GO:0051276	0.950	chromosome organization
GO:0045143	0.909	homologous chromosome segregation
GO:0070192	0.880	chromosome organization involved in meiotic cell cycle
GO:0070193	0.857	synaptonemal complex organization
GO:0007129	0.855	homologous chromosome pairing at meiosis
GO:0044085	0.768	cellular component biogenesis
GO:0022607	0.755	cellular component assembly
GO:0000712	0.479	resolution of meiotic recombination intermediates
GO:0050896	0.342	response to stimulus
GO:0007130	0.301	synaptonemal complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000228	0.999	nuclear chromosome
GO:0000794	0.994	condensed nuclear chromosome
GO:0005654	0.944	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	1.000	ATP + H2O = ADP + H(+) + phosphate

[back to server]