StarFunc result for job id Q5VY43

User Input

>input (1037 residues)
MSPPLCPLLLLAVGLRLAGTLNPSDPNTCSFWESFTTTTKESHSRPFSLLPSEPCERPWE
GPHTCPQPTVVYRTVYRQVVKTDHRQRLQCCHGFYESRGFCVPLCAQECVHGRCVAPNQC
QCVPGWRGDDCSSECAPGMWGPQCDKPCSCGNNSSCDPKSGVCSCPSGLQPPNCLQPCTP
GYYGPACQFRCQCHGAPCDPQTGACFCPAERTGPSCDVSCSQGTSGFFCPSTHSCQNGGV
FQTPQGSCSCPPGWMGTICSLPCPEGFHGPNCSQECRCHNGGLCDRFTGQCRCAPGYTGD
RCREECPVGRFGQDCAETCDCAPDARCFPANGACLCEHGFTGDRCTDRLCPDGFYGLSCQ
APCTCDREHSLSCHPMNGECSCLPGWAGLHCNESCPQDTHGPGCQEHCLCLHGGVCQATS
GLCQCAPGYTGPHCASLCPPDTYGVNCSARCSCENAIACSPIDGECVCKEGWQRGNCSVP
CPPGTWGFSCNASCQCAHEAVCSPQTGACTCTPGWHGAHCQLPCPKGQFGEGCASRCDCD
HSDGCDPVHGRCQCQAGWMGARCHLSCPEGLWGVNCSNTCTCKNGGTCLPENGNCVCAPG
FRGPSCQRSCQPGRYGKRCVPCKCANHSFCHPSNGTCYCLAGWTGPDCSQPCPPGHWGEN
CAQTCQCHHGGTCHPQDGSCICPLGWTGHHCLEGCPLGTFGANCSQPCQCGPGEKCHPET
GACVCPPGHSGAPCRIGIQEPFTVMPTTPVAYNSLGAVIGIAVLGSLVVALVALFIGYRH
WQKGKEHHHLAVAYSSGRLDGSEYVMPDVPPSYSHYYSNPSYHTLSQCSPNPPPPNKVPG
PLFASLQNPERPGGAQGHDNHTTLPADWKHRREPPPGPLDRGSSRLDRSYSYSYSNGPGP
FYNKGLISEEELGASVASLSSENPYATIRDLPSLPGGPRESSYMEMKGPPSGSPPRQPPQ
FWDSQRRRQPQPQRDSGTYEQPSPLIHDRDSVGSQPPLPPGLPPGHYDSPKNSHIPGHYD
LPPVRHPPSPPLRRQDR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6BM72	0.184	0.183	0.000	1044	0.433	0.430	A6BM72.pdb.gz	MEG11_HUMAN Multiple epidermal growth factor-like domains protein 11 OS=Homo sapiens OX=9606 GN=MEGF11 PE=1 SV=3
2	AFDB:Q5VY43	0.999	0.999	0.000	1037	1.000	1.000	Q5VY43.pdb.gz	PEAR1_HUMAN Platelet endothelial aggregation receptor 1 OS=Homo sapiens OX=9606 GN=PEAR1 PE=1 SV=1
3	AFDB:Q80T91	0.260	0.248	0.000	1091	0.436	0.414	Q80T91.pdb.gz	MEG11_MOUSE Multiple epidermal growth factor-like domains protein 11 OS=Mus musculus OX=10090 GN=Megf11 PE=1 SV=3
4	AFDB:Q8VIK5	0.497	0.498	0.000	1034	0.841	0.843	Q8VIK5.pdb.gz	PEAR1_MOUSE Platelet endothelial aggregation receptor 1 OS=Mus musculus OX=10090 GN=Pear1 PE=1 SV=1
5	AFDB:Q6DIB5	0.216	0.197	6.493E-104	1147	0.467	0.422	Q6DIB5.pdb.gz	MEG10_MOUSE Multiple epidermal growth factor-like domains protein 10 OS=Mus musculus OX=10090 GN=Megf10 PE=1 SV=1
6	AFDB:Q9XWD6	0.193	0.183	1.670E-78	1111	0.299	0.279	Q9XWD6.pdb.gz	CED1_CAEEL Cell death abnormality protein 1 OS=Caenorhabditis elegans OX=6239 GN=ced-1 PE=1 SV=1
7	PDB:5es4B	0.048	0.066	3.276E-3	674	0.044	0.068	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
8	PDB:7q3nU	0.063	0.166	6.188E-2	292	0.037	0.130	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
9	PDB:7nxdB	0.061	0.083	7.307E-2	690	0.038	0.057	7nxdB.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
10	AFDB:D4A0Z7	0.036	0.034	2.346E-1	1108	0.063	0.059	D4A0Z7.pdb.gz	D4A0Z7_RAT BOC cell adhesion associated, oncogene regulated OS=Rattus norvegicus OX=10116 GN=Boc PE=4 SV=3
11	PDB:6uzbA	0.030	0.041	2.765E-1	562	0.008	0.014	6uzbA.pdb.gz	Atomic structures of anthrax toxin protective antigen channels bound to partially unfolded lethal and edema factors.
12	PDB:3b07B	0.033	0.099	4.553E-1	270	0.009	0.033	3b07B.pdb.gz
13	AFDB:Q1L8D0	0.042	0.039	7.945E-1	1125	0.060	0.055	Q1L8D0.pdb.gz	Q1L8D0_DANRE Cell adhesion molecule-related/down-regulated by oncogenes OS=Danio rerio OX=7955 GN=zgc:158240 PE=2 SV=2
14	AFDB:O35158	0.040	0.034	8.397E-1	1256	0.052	0.043	O35158.pdb.gz	CDON_RAT Cell adhesion molecule-related/down-regulated by oncogenes OS=Rattus norvegicus OX=10116 GN=Cdon PE=1 SV=2
15	PDB:6sb3A	0.042	0.066	8.857E-1	604	0.012	0.020	6sb3A.pdb.gz
16	AFDB:O35569	0.035	0.041	1.633	868	0.073	0.088	O35569.pdb.gz	NRG2_RAT Pro-neuregulin-2, membrane-bound isoform OS=Rattus norvegicus OX=10116 GN=Nrg2 PE=1 SV=1
17	PDB:3b07A	0.031	0.097	2.837	284	0.005	0.018	3b07A.pdb.gz
18	PDB:3m3rC	0.031	0.084	4.183	293	0.007	0.024	3m3rC.pdb.gz
19	PDB:6qz90A	0.038	0.097	4.421	291	0.005	0.017	6qz90A.pdb.gz
20	PDB:4h56A	0.030	0.088	4.940	267	0.007	0.026	4h56A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6BM72	0.0	693	1044	0.359	0.356	MEG11_HUMAN Multiple epidermal growth factor-like domains protein 11 OS=Homo sapiens OX=9606 GN=MEGF11 PE=1 SV=3
2	E9QJQ6	0.0	758	1119	0.455	0.422	MEG10_DANRE Multiple epidermal growth factor-like domains protein 10 OS=Danio rerio OX=7955 GN=megf10 PE=1 SV=1
3	Q5VY43	0.0	2055	1037	1.000	1.000	PEAR1_HUMAN Platelet endothelial aggregation receptor 1 OS=Homo sapiens OX=9606 GN=PEAR1 PE=1 SV=1
4	Q6DIB5	0.0	789	1147	0.467	0.422	MEG10_MOUSE Multiple epidermal growth factor-like domains protein 10 OS=Mus musculus OX=10090 GN=Megf10 PE=1 SV=1
5	Q80T91	0.0	717	1091	0.439	0.417	MEG11_MOUSE Multiple epidermal growth factor-like domains protein 11 OS=Mus musculus OX=10090 GN=Megf11 PE=1 SV=3
6	Q8VIK5	0.0	1593	1034	0.825	0.828	PEAR1_MOUSE Platelet endothelial aggregation receptor 1 OS=Mus musculus OX=10090 GN=Pear1 PE=1 SV=1
7	Q96KG7	0.0	785	1140	0.467	0.425	MEG10_HUMAN Multiple epidermal growth factor-like domains protein 10 OS=Homo sapiens OX=9606 GN=MEGF10 PE=1 SV=1
8	Q9W0A0	1.59e-171	531	1031	0.333	0.335	DRPR_DROME Protein draper OS=Drosophila melanogaster OX=7227 GN=drpr PE=1 SV=3
9	Q80V70	4.74e-127	424	1572	0.251	0.165	MEGF6_MOUSE Multiple epidermal growth factor-like domains protein 6 OS=Mus musculus OX=10090 GN=Megf6 PE=2 SV=3
10	Q9XWD6	6.51e-127	416	1111	0.262	0.245	CED1_CAEEL Cell death abnormality protein 1 OS=Caenorhabditis elegans OX=6239 GN=ced-1 PE=1 SV=1
11	O75095	1.36e-125	420	1541	0.257	0.173	MEGF6_HUMAN Multiple epidermal growth factor-like domains protein 6 OS=Homo sapiens OX=9606 GN=MEGF6 PE=1 SV=4
12	Q14162	1.07e-50	195	830	0.145	0.181	SREC_HUMAN Scavenger receptor class F member 1 OS=Homo sapiens OX=9606 GN=SCARF1 PE=1 SV=3
13	Q5ND28	1.06e-48	189	820	0.146	0.184	SREC_MOUSE Scavenger receptor class F member 1 OS=Mus musculus OX=10090 GN=Scarf1 PE=1 SV=1
14	Q96GP6	4.67e-46	181	871	0.132	0.157	SREC2_HUMAN Scavenger receptor class F member 2 OS=Homo sapiens OX=9606 GN=SCARF2 PE=1 SV=5
15	P59222	6.39e-44	174	833	0.122	0.151	SREC2_MOUSE Scavenger receptor class F member 2 OS=Mus musculus OX=10090 GN=Scarf2 PE=1 SV=1
16	O18977	2.42e-31	136	4135	0.204	0.051	O18977_BOVIN Tenascin-X OS=Bos taurus OX=9913 GN=TN-X PE=2 SV=1
17	F1QYE2	3.31e-31	135	1811	0.166	0.095	F1QYE2_DANRE Tenascin C OS=Danio rerio OX=7955 GN=tenc PE=1 SV=1
18	E9QHI1	3.93e-31	135	1720	0.166	0.100	E9QHI1_DANRE Tenascin C OS=Danio rerio OX=7955 GN=tenc PE=1 SV=1
19	A5A8W4	7.56e-31	134	4137	0.202	0.051	A5A8W4_PIG Tenascin XB OS=Sus scrofa OX=9823 GN=TNXB PE=3 SV=1
20	Q80YX1	3.32e-30	132	2110	0.175	0.086	TENA_MOUSE Tenascin OS=Mus musculus OX=10090 GN=Tnc PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01414 DSL	32	16.3	Delta serrate ligand
2	PF19744 DUF6232	4.2e+02	12.7	Family of unknown function (DUF6232)
3	PF00008 EGF	19	17.0	EGF-like domain
4	PF07974 EGF_2	0.00018	33.1	EGF-like domain
5	PF12661 hEGF	0.18	23.7	Human growth factor-like EGF
6	PF00053 Laminin_EGF	7.7e-31	117.3	Laminin EGF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344465

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264554	0.803	SHC-transforming protein 2
2	9606.ENSP00000336661	0.754	Leucine-rich repeat-containing protein 71
3	9606.ENSP00000263246	0.678	Protein kinase C and casein kinase substrate in neurons protein 2
4	9606.ENSP00000354451	0.673	Ras GTPase-activating-like protein IQGAP3
5	9606.ENSP00000267113	0.642	Extended synaptotagmin-1
6	9606.ENSP00000348632	0.642	RanBP-type and C3HC4-type zinc finger-containing protein 1
7	9606.ENSP00000334319	0.625	Protein piccolo
8	9606.ENSP00000352121	0.621	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
9	9606.ENSP00000369081	0.620	Thioredoxin domain-containing protein 5
10	9606.ENSP00000372210	0.614	BET1-like protein
11	9606.ENSP00000430271	0.611	ETS translocation variant 3-like protein
12	9606.ENSP00000288912	0.603	Cilia- and flagella-associated protein 251
13	9606.ENSP00000264607	0.588	Ankyrin repeat and SOCS box protein 1
14	9606.ENSP00000311778	0.588	Zinc finger MIZ domain-containing protein 2
15	9606.ENSP00000382204	0.569	Probable JmjC domain-containing histone demethylation protein 2C
16	9606.ENSP00000362680	0.557	Proto-oncogene tyrosine-protein kinase Src
17	9606.ENSP00000308782	0.556	Platelet glycoprotein VI
18	9606.ENSP00000357177	0.549	Rho guanine nucleotide exchange factor 11
19	9606.ENSP00000412130	0.546	Protein MRVI1
20	9606.ENSP00000396441	0.545	G-patch domain containing 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0060089	0.675	molecular transducer activity
GO:0005102	0.411	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050896	0.986	response to stimulus
GO:0050794	0.986	regulation of cellular process
GO:0032501	0.954	multicellular organismal process
GO:0023052	0.916	signaling
GO:0051716	0.913	cellular response to stimulus
GO:0007155	0.903	cell adhesion
GO:0007165	0.896	signal transduction
GO:0098609	0.894	cell-cell adhesion
GO:0050817	0.794	coagulation
GO:0050878	0.793	regulation of body fluid levels
GO:0006950	0.775	response to stress
GO:0007599	0.768	hemostasis
GO:0051179	0.767	localization
GO:0009611	0.754	response to wounding
GO:0051234	0.750	establishment of localization
GO:0016192	0.743	vesicle-mediated transport
GO:0035556	0.734	intracellular signal transduction
GO:0007596	0.730	blood coagulation
GO:0006909	0.624	phagocytosis
GO:0034109	0.500	homotypic cell-cell adhesion
GO:0032502	0.487	developmental process
GO:0001775	0.485	cell activation
GO:0048856	0.480	anatomical structure development
GO:0043277	0.466	apoptotic cell clearance
GO:0048518	0.456	positive regulation of biological process
GO:0048731	0.412	system development
GO:0048522	0.361	positive regulation of cellular process
GO:0048869	0.354	cellular developmental process
GO:0048583	0.315	regulation of response to stimulus
GO:0030168	0.303	platelet activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0001891	0.778	phagocytic cup
GO:0005622	0.717	intracellular anatomical structure
GO:0005737	0.687	cytoplasm
GO:0043226	0.674	organelle
GO:0043227	0.634	membrane-bounded organelle
GO:0043231	0.614	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]