StarFunc result for job id Q5VYJ5

User Input

>input (2156 residues)
MLFFLDRMLAFPMNETFCCLWIACVFNSTLAQQGTESFQCDNGVSLPPDSICDFTDQCGD
SSDERHCLNYERCDFEDGLCHMTQDQSLQPSWTKRSGMIGLSPPFYDHNGDVSAHFLSLV
SRVDSISSSLRSRVFLPTNDQHDCQITFYYFSCQVSGKLMVGLQTACGGPIQHLWQNTAA
LPNQWERNVIKIQSSQRFQVVFEGQMASTYEQDEVIAIDDISFSSGCLPANDGILLCQEA
LNAERELCHPDTDLCRFDATDEELRLCQACGFEFDMCEWTSEASAGQISWMRTKAREIPA
FESTPQQDQGGDDEGYYVWVGAKHGFTLNHLDSRAYLNSSVCHCLGKSCHLQFYYAMESS
VLRVRLYNNKEEEIFWTYNISTHSQWVKADVLIPEDLKTFKIIFEGTLLSQRSFIALDHL
WVYACGQTQSRKLCSADEFPCTSGQCIAKESVCDSRQDCSDESDEDPATCSKHLTCDFES
GFCGWEPFLTEDSHWKLMKGLNNGEHHFPAADHTANINHGSFIYLEAQRSPGVAKLGSPV
LTKLLTASTPCQVQFWYHLSQHSNLSVFTRTSLDGNLQKQGKIIRFSESQWSHAKIDLIA
EAGESTLPFQLILEATVLSSNATVALDDISVSQECEISYKSLPRTSTQSKFSKCDFEANS
CDWFEAISGDHFDWIRSSQSELSADFEHQAPPRDHSLNASQGHFMFILKKSSSLWQVAKL
QSPTFSQTGPGCILSFWFYNYGLSVGAAELQLHMENSHDSTVIWRVLYNQGKQWLEATIQ
LGRLSQPFHLSLDKVSLGIYDGVSAIDDIRFENCTLPLPAESCEGLDHFWCRHTRACIEK
LRLCDLVDDCGDRTDEVNCAPELQCNFETGICNWEQDAKDDFDWTRSQGPTPTLNTGPMK
DNTLGTAKGHYLYIESSEPQAFQDSAALLSPILNATDTKGCTFRFYYHMFGKRIYRLAIY
QRIWSDSRGQLLWQIFGNQGNRWIRKHLNISSRQPFQILVEASVGDGFTGDIAIDDLSFM
DCTLYPGNLPADLPTPPETSVPVTLPPHNCTDNEFICRSDGHCIEKMQKCDFKYDCPDKS
DEASCVMEVCSFEKRSLCKWYQPIPVHLLQDSNTFRWGLGNGISIHHGEENHRPSVDHTQ
NTTDGWYLYADSSNGKFGDTADILTPIISLTGPKCTLVFWTHMNGATVGSLQVLIKKDNV
TSKLWAQTGQQGAQWKRAEVFLGIRSHTQIVFRAKRGISYIGDVAVDDISFQDCSPLLSP
ERKCTDHEFMCANKHCIAKDKLCDFVNDCADNSDETTFICRTSSGRCDFEFDLCSWKQEK
DEDFDWNLKASSIPAAGTEPAADHTLGNSSGHYIFIKSLFPQQPMRAARISSPVISKRSK
NCKIIFHYHMYGNGIGALTLMQVSVTNQTKVLLNLTVEQGNFWRREELSLFGDEDFQLKF
EGRVGKGQRGDIALDDIVLTENCLSLHDSVQEELAVPLPTGFCPLGYRECHNGKCYRLEQ
SCNFVDNCGDNTDENECGSSCTFEKGWCGWQNSQADNFDWVLGVGSHQSLRPPKDHTLGN
ENGHFMYLEATAVGLRGDKAHFRSTMWRESSAACTMSFWYFVSAKATGSIQILIKTEKGL
SKVWQESKQNPGNHWQKADILLGKLRNFEVIFQGIRTRDLGGGAAIDDIEFKNCTTVGEI
SELCPEITDFLCRDKKCIASHLLCDYKPDCSDRSDEAHCAHYTSTTGSCNFETSSGNWTT
ACSLTQDSEDDLDWAIGSRIPAKALIPDSDHTPGSGQHFLYVNSSGSKEGSVARITTSKS
FPASLGMCTVRFWFYMIDPRSMGILKVYTIEESGLNILVWSVIGNKRTGWTYGSVPLSSN
SPFKVAFEADLDGNEDIFIALDDISFTPECVTGGPVPVQPSPCEADQFSCIYTLQCVPLS
GKCDGHEDCIDGSDEMDCPLSPTPPLCSNMEFPCSTDECIPSLLLCDGVPDCHFNEDELI
CSNKSCSNGALVCASSNSCIPAHQRCDGFADCMDFQLDESSCSECPLNYCRNGGTCVVEK
NGPMCRCRQGWKGNRCHIKFNPPATDFTYAQNNTWTLLGIGLAFLMTHITVAVLCFLANR
KVPIRKTEGSGNCAFVNPVYGNWSNPEKTESSVYSFSNPLYGTTSGSLETLSHHLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AJX4	0.549	0.556	0.000	2123	0.715	0.726	A2AJX4.pdb.gz	MALR1_MOUSE MAM and LDL-receptor class A domain-containing protein 1 OS=Mus musculus OX=10090 GN=Malrd1 PE=1 SV=2
2	AFDB:Q5VYJ5	1.000	1.000	0.000	2156	1.000	1.000	Q5VYJ5.pdb.gz	MALR1_HUMAN MAM and LDL-receptor class A domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MALRD1 PE=1 SV=4
3	AFDB:Q63191	0.164	0.284	3.090E-72	1216	0.132	0.234	Q63191.pdb.gz	AEGP_RAT Apical endosomal glycoprotein OS=Rattus norvegicus OX=10116 GN=Mamdc4 PE=1 SV=1
4	AFDB:Q7Z304	0.078	0.213	9.491E-39	686	0.078	0.246	Q7Z304.pdb.gz	MAMC2_HUMAN MAM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAMDC2 PE=1 SV=3
5	AFDB:P98072	0.077	0.147	4.750E-25	1035	0.066	0.137	P98072.pdb.gz	ENTK_BOVIN Enteropeptidase OS=Bos taurus OX=9913 GN=TMPRSS15 PE=1 SV=1
6	AFDB:Q7KJ08	0.136	0.167	1.185E-23	1701	0.058	0.073	Q7KJ08.pdb.gz	Q7KJ08_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Alk PE=2 SV=1
7	AFDB:P98073	0.074	0.150	2.555E-23	1019	0.065	0.138	P98073.pdb.gz	ENTK_HUMAN Enteropeptidase OS=Homo sapiens OX=9606 GN=TMPRSS15 PE=1 SV=3
8	AFDB:Q8QFX6	0.105	0.189	3.421E-21	923	0.064	0.151	Q8QFX6.pdb.gz	NRP1A_DANRE Neuropilin-1a OS=Danio rerio OX=7955 GN=nrp1a PE=2 SV=1
9	AFDB:O14786	0.100	0.157	1.927E-20	923	0.054	0.126	O14786.pdb.gz	NRP1_HUMAN Neuropilin-1 OS=Homo sapiens OX=9606 GN=NRP1 PE=1 SV=3
10	AFDB:Q6T491	0.075	0.152	4.358E-20	921	0.057	0.132	Q6T491.pdb.gz
11	PDB:6vlsD	0.057	0.111	1.406E-8	963	0.029	0.064	6vlsD.pdb.gz
12	PDB:7ufgA	0.051	0.083	2.073E-6	1151	0.037	0.069	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
13	PDB:7l2zF	0.044	0.117	2.512E-6	664	0.021	0.068	7l2zF.pdb.gz
14	PDB:7kveB	0.058	0.081	7.223E-6	1374	0.068	0.107	7kveB.pdb.gz
15	PDB:8a7eC	0.063	0.083	1.113E-5	1524	0.051	0.072	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
16	PDB:7ufgB	0.051	0.084	1.285E-5	1182	0.022	0.041	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
17	PDB:5eiyB	0.049	0.126	1.714E-5	658	0.021	0.068	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.
18	PDB:7q1yA	0.043	0.056	4.068E-5	1374	0.073	0.114	7q1yA.pdb.gz
19	PDB:2vqaA	0.031	0.108	4.478E-5	356	0.015	0.093	2vqaA.pdb.gz	Protein-Folding Location Can Regulate Manganese-Binding Versus Copper- or Zinc-Binding.
20	PDB:1uijC	0.033	0.096	7.593E-5	346	0.016	0.101	1uijC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AJX4	0.0	3247	2123	0.715	0.726	MALR1_MOUSE MAM and LDL-receptor class A domain-containing protein 1 OS=Mus musculus OX=10090 GN=Malrd1 PE=1 SV=2
2	H0Y3D6	0.0	1001	507	0.223	0.947	H0Y3D6_HUMAN MAM and LDL receptor class A domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MALRD1 PE=1 SV=1
3	Q5VYJ5	0.0	4487	2156	1.000	1.000	MALR1_HUMAN MAM and LDL-receptor class A domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MALRD1 PE=1 SV=4
4	U5GXS0	0.0	2736	1486	0.629	0.913	U5GXS0_HUMAN MAM and LDL receptor class A domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MALRD1 PE=1 SV=1
5	Q63191	1.81e-82	300	1216	0.146	0.259	AEGP_RAT Apical endosomal glycoprotein OS=Rattus norvegicus OX=10116 GN=Mamdc4 PE=1 SV=1
6	Q8CG85	3.12e-39	160	686	0.080	0.252	MAMC2_MOUSE MAM domain-containing protein 2 OS=Mus musculus OX=10090 GN=Mamdc2 PE=1 SV=1
7	Q7Z304	2.83e-34	144	686	0.084	0.264	MAMC2_HUMAN MAM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAMDC2 PE=1 SV=3
8	A0A3B3IU48	6.80e-29	129	973	0.033	0.073	A0A3B3IU48_HUMAN MAM domain containing glycosylphosphatidylinositol anchor 1 OS=Homo sapiens OX=9606 GN=MDGA1 PE=1 SV=1
9	Q8NFP4	7.08e-29	129	955	0.033	0.074	MDGA1_HUMAN MAM domain-containing glycosylphosphatidylinositol anchor protein 1 OS=Homo sapiens OX=9606 GN=MDGA1 PE=1 SV=1
10	Q0WYX8	9.53e-29	128	949	0.033	0.075	MDGA1_CHICK MAM domain-containing glycosylphosphatidylinositol anchor protein 1 OS=Gallus gallus OX=9031 GN=MDGA1 PE=1 SV=1
11	P85171	1.22e-28	128	956	0.035	0.078	MDGA1_RAT MAM domain-containing glycosylphosphatidylinositol anchor protein 1 OS=Rattus norvegicus OX=10116 GN=Mdga1 PE=1 SV=1
12	Q0PMG2	1.50e-28	127	956	0.032	0.073	MDGA1_MOUSE MAM domain-containing glycosylphosphatidylinositol anchor protein 1 OS=Mus musculus OX=10090 GN=Mdga1 PE=2 SV=3
13	Q7KJ08	2.12e-27	124	1701	0.051	0.065	Q7KJ08_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Alk PE=2 SV=1
14	Q7Z553	2.18e-25	117	956	0.033	0.075	MDGA2_HUMAN MAM domain-containing glycosylphosphatidylinositol anchor protein 2 OS=Homo sapiens OX=9606 GN=MDGA2 PE=1 SV=2
15	P60755	3.11e-25	117	949	0.036	0.081	MDGA2_MOUSE MAM domain-containing glycosylphosphatidylinositol anchor protein 2 OS=Mus musculus OX=10090 GN=Mdga2 PE=1 SV=1
16	P60756	3.48e-25	117	949	0.036	0.081	MDGA2_RAT MAM domain-containing glycosylphosphatidylinositol anchor protein 2 OS=Rattus norvegicus OX=10116 GN=Mdga2 PE=2 SV=1
17	F1QVU0	1.85e-21	105	1530	0.051	0.071	LTK_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=ltk PE=1 SV=1
18	P98073	3.01e-20	100	1019	0.030	0.064	ENTK_HUMAN Enteropeptidase OS=Homo sapiens OX=9606 GN=TMPRSS15 PE=1 SV=3
19	P98072	3.91e-19	97.4	1035	0.028	0.059	ENTK_BOVIN Enteropeptidase OS=Bos taurus OX=9913 GN=TMPRSS15 PE=1 SV=1
20	O88799	4.74e-18	94.4	5376	0.045	0.018	ZAN_MOUSE Zonadhesin OS=Mus musculus OX=10090 GN=Zan PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00008 EGF	0.15	23.7	EGF-like domain
2	PF12661 hEGF	0.26	23.2	Human growth factor-like EGF
3	PF00057 Ldl_recept_a	1.6e-58	205.9	Low-density lipoprotein receptor domain class A
4	PF00629 MAM	6e-272	902.4	MAM domain, meprin/A5/mu

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000412763

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000468782	0.768	Zinc finger and BTB domain-containing protein 7C
2	9606.ENSP00000353732	0.736	CAP-Gly domain-containing linker protein 3
3	9606.ENSP00000313504	0.714	Phosphorylase b kinase regulatory subunit beta
4	9606.ENSP00000479816	0.692	DENN domain-containing protein 1B
5	9606.ENSP00000221891	0.690	Amyloid-like protein 1
6	9606.ENSP00000252486	0.638	Apolipoprotein E
7	9606.ENSP00000378187	0.629	Adenylate cyclase type 7
8	9606.ENSP00000287008	0.625	Protocadherin-1
9	9606.ENSP00000262622	0.606	Carbohydrate sulfotransferase 8
10	9606.ENSP00000447149	0.597	Bile acid receptor
11	9606.ENSP00000292408	0.576	Fibroblast growth factor receptor 4
12	9606.ENSP00000367151	0.522	Protocadherin-17
13	9606.ENSP00000419325	0.515	Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial
14	9606.ENSP00000254227	0.511	Nuclear receptor subfamily 0 group B member 2
15	9606.ENSP00000264896	0.511	Lysosome membrane protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050794	0.988	regulation of cellular process
GO:0019222	0.970	regulation of metabolic process
GO:0080090	0.957	regulation of primary metabolic process
GO:0062012	0.954	regulation of small molecule metabolic process
GO:0019216	0.948	regulation of lipid metabolic process
GO:0048519	0.937	negative regulation of biological process
GO:0019218	0.923	regulation of steroid metabolic process
GO:0031323	0.919	regulation of cellular metabolic process
GO:0050810	0.914	regulation of steroid biosynthetic process
GO:0048523	0.887	negative regulation of cellular process
GO:0010565	0.885	regulation of cellular ketone metabolic process
GO:0009987	0.873	cellular process
GO:0048878	0.794	chemical homeostasis
GO:0045833	0.764	negative regulation of lipid metabolic process
GO:0055088	0.752	lipid homeostasis
GO:0062014	0.717	negative regulation of small molecule metabolic process
GO:0055092	0.668	sterol homeostasis
GO:0031326	0.635	regulation of cellular biosynthetic process
GO:0051055	0.563	negative regulation of lipid biosynthetic process
GO:0042632	0.329	cholesterol homeostasis
GO:0008152	0.315	metabolic process
GO:0071704	0.309	organic substance metabolic process
GO:0031324	0.302	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.993	endomembrane system
GO:0005794	0.962	Golgi apparatus
GO:0005886	0.389	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]