StarFunc result for job id Q5VYK3

User Input

>input (1845 residues)
MAAAAASASQDELNQLERVFLRLGHAETDEQLQNIISKFLPPVLLKLSSTQEGVRKKVME
LLVHLNKRIKSRPKIQLPVETLLVQYQDPAAVSFVTNFTIIYVKMGYPRLPVEKQCELAP
TLLTAMEGKPQPQQDSLMHLLIPTLFHMKYPVESSKSASPFNLAEKPKTVQLLLDFMLDV
LLMPYGYVLNESQSRQNSSSAQGSSSNSGGGSGIPQPPPGMSFYAAKRVIGDNPWTPEQL
EQCKLGIVKFIEAEQVPELEAVLHLVIASSDTRHSVATAADLELKSKQSLIDWNNPAIIN
KMYKVYLGDIPLKTKEGAVLKPELKRDPVSTRVKLKIVPHLLRSRQAAETFPANIQVVYD
GLFGTNTNSKLRTLSLQFVHHICITCPEIKIKPLGPMLLNGLTKLINEYKEDPKLLSMAY
SAVGKLSSRMPHLFTKDIALVQQLFEALCKEEPETRLAIQEALSMMVGAYSTLEGAQRTL
MEALVASYLIKPEVQVRQVAVKFASTVFPSDHIPSRYLLLLAAGDPREEVHGEAQRVLRC
LPGRNRKESTSEQMPSFPEMVYYIQEKASHRMKTPVKYMTGTTVLPFNPAAFGEIVLYLR
MCLAHSAGVVPTSQSLADMQDHAPAIGRYIRTLMSSGQMAPSSSNKSGETNPVQIYIGLL
QQLLAGVGGLPVMYCLLEAVSVYPEKLATKFVDKTEWIKSLMNNSKEEMRELAALFYSVV
VSTVSGNELKSMIEQLIKTTKDNHSPEIQHGSLLALGFTVGRYLAKKKMRMSEQQDLERN
ADTLPDQEELIQSATETIGSFLDSTSPLLAIAACTALGEIGRNGPLPIPSEGSGFTKLHL
VESLLSRIPSSKETNKMKERAIQTLGYFPVGDGDFPHQKLLLQGLMDSVEAKQIELQFTI
GEAITSAAIGTSSVAARDAWQMTEEEYTPPAGAKVNDVVPWVLDVILNKHIISPNPHVRQ
AACIWLLSLVRKLSTHKEVKSHLKEIQSAFVSVLSENDELSQDVASKGLGLVYELGNEQD
QQELVSTLVETLMTGKRVKHEVSGETVVFQGGALGKTPDGQGLSTYKELCSLASDLSQPD
LVYKFMNLANHHAMWNSRKGAAFGFNVIATRAGEQLAPFLPQLVPRLYRYQFDPNLGIRQ
AMTSIWNALVTDKSMVDKYLKEILQDLVKNLTSNMWRVRESSCLALNDLLRGRPLDDIID
KLPEIWETLFRVQDDIKESVRKAAELALKTLSKVCVKMCDPAKGAAGQRTIAALLPCLLD
KGMMSTVTEVRALSINTLVKISKSAGAMLKPHAPKLIPALLESLSVLEPQVLNYLSLRAT
EQEKAAMDSARLSAAKSSPMMETINMCLQYLDVSVLGELVPRLCELIRSGVGLGTKGGCA
SVIVSLTTQCPQDLTPYSGKLMSALLSGLTDRNSVIQKSCAFAMGHLVRTSRDSSTEKLL
QKLNGWYMEKEEPIYKTSCALTIHAIGRYSPDVLKNHAKEVLPLAFLGMHEIADEEKSEK
EECNLWTEVWQENVPGSFGGIRLYLQELITITQKALQSQSWKMKAQGAIAMASIAKQTSS
LVPPYLGMILTALLQGLAGRTWAGKEELLKAIACVVTACSAELEKSVPNQPSTNEILQAV
LKECSKENVKYKIVAISCAADILKATKEDRFQEFSNIVIPLIKKNSLESSGVRTTKNEEE
NEKEKELQLEYLLGAFESLGKAWPRNAETQRCYRQELCKLMCERLKLSTWKVQLGVLQSM
NAFFQGLMLLEEEHADPEALAEILLETCKSITYSLENKTYSSVRTEALSVIELLLKKLEE
SKQWECLTSECRVLLIESLATMEPDSRPELQEKAALLKKTLENLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VYK3	1.000	1.000	0.000	1845	1.000	1.000	Q5VYK3.pdb.gz	ECM29_HUMAN Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2
2	AFDB:A0A1D8PKU7	0.595	0.592	1.872E-56	1859	0.236	0.234	A0A1D8PKU7.pdb.gz	A0A1D8PKU7_CANAL Ecm29p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ECM29 PE=4 SV=1
3	AFDB:P38737	0.689	0.682	5.643E-55	1868	0.230	0.228	P38737.pdb.gz	ECM29_YEAST Proteasome component ECM29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ECM29 PE=1 SV=1
4	AFDB:Q9P7H8	0.673	0.731	6.099E-52	1679	0.210	0.231	Q9P7H8.pdb.gz	ECM29_SCHPO Proteasome component ecm29 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ecm29 PE=1 SV=1
5	AFDB:F4I893	0.147	0.110	3.136E-20	2696	0.124	0.085	F4I893.pdb.gz	ILA_ARATH Protein ILITYHIA OS=Arabidopsis thaliana OX=3702 GN=ILA PE=1 SV=1
6	AFDB:E9PVA8	0.158	0.122	8.895E-20	2671	0.164	0.113	E9PVA8.pdb.gz	GCN1_MOUSE Stalled ribosome sensor GCN1 OS=Mus musculus OX=10090 GN=Gcn1 PE=1 SV=1
7	AFDB:Q10105	0.154	0.115	1.013E-18	2670	0.122	0.084	Q10105.pdb.gz	GCN1_SCHPO eIF-2-alpha kinase activator gcn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn1 PE=3 SV=1
8	AFDB:B3CJ34	0.144	0.111	1.086E-18	2634	0.153	0.107	B3CJ34.pdb.gz	B3CJ34_CAEEL TOG domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gcn-1 PE=1 SV=3
9	AFDB:P33892	0.157	0.118	2.501E-18	2672	0.158	0.109	P33892.pdb.gz	GCN1_YEAST eIF-2-alpha kinase activator GCN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN1 PE=1 SV=1
10	AFDB:F4I718	0.248	0.227	2.611E-15	2136	0.134	0.116	F4I718.pdb.gz	CSI3_ARATH Protein CELLULOSE SYNTHASE INTERACTIVE 3 OS=Arabidopsis thaliana OX=3702 GN=CSI3 PE=1 SV=1
11	PDB:7su3A	0.151	0.087	7.585E-13	3802	0.122	0.059	7su3A.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
12	PDB:6xu2A	0.154	0.236	1.468E-12	1091	0.095	0.161	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
13	PDB:7mqaSP	0.168	0.133	2.473E-12	2485	0.147	0.109	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:6ez8A	0.143	0.119	4.022E-12	2353	0.143	0.112	6ez8A.pdb.gz
15	PDB:7mq8LM	0.200	0.189	4.955E-12	2005	0.137	0.126	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:4a0cA	0.175	0.245	8.640E-12	1155	0.089	0.143	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
17	PDB:6x9oA	0.143	0.121	8.640E-12	2425	0.148	0.113	6x9oA.pdb.gz
18	PDB:7unkA	0.153	0.244	2.060E-11	1047	0.091	0.160	7unkA.pdb.gz
19	PDB:6bcuA	0.161	0.139	2.208E-11	2204	0.124	0.104	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
20	PDB:7sglA	0.153	0.089	5.085E-11	3852	0.136	0.065	7sglA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3KN16	0.0	3760	2017	0.994	0.909	J3KN16_HUMAN Ecm29 proteasome adaptor and scaffold OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=1
2	Q5VYK3	0.0	3788	1845	1.000	1.000	ECM29_HUMAN Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2
3	R4GMY1	0.0	1836	890	0.482	1.000	R4GMY1_HUMAN Ecm29 proteasome adaptor and scaffold (Fragment) OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=1
4	A0A1D8PKU7	5.87e-107	382	1859	0.153	0.152	A0A1D8PKU7_CANAL Ecm29p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ECM29 PE=4 SV=1
5	P38737	1.61e-100	362	1868	0.132	0.131	ECM29_YEAST Proteasome component ECM29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ECM29 PE=1 SV=1
6	Q6FV91	7.44e-99	357	1896	0.126	0.122	Q6FV91_CANGA Candida glabrata strain CBS138 chromosome E complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0E03828g PE=4 SV=1
7	Q9P7H8	1.03e-89	327	1679	0.198	0.217	ECM29_SCHPO Proteasome component ecm29 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ecm29 PE=1 SV=1
8	C8V020	6.78e-07	57.4	2672	0.051	0.035	C8V020_EMENI Translational activator, putative (AFU_orthologue AFUA_2G07960) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10734 PE=4 SV=1
9	F4I893	2.98e-05	52.0	2696	0.080	0.055	ILA_ARATH Protein ILITYHIA OS=Arabidopsis thaliana OX=3702 GN=ILA PE=1 SV=1
10	Q92616	5.05e-04	47.8	2671	0.040	0.027	GCN1_HUMAN Stalled ribosome sensor GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=7
11	E9PVA8	0.001	46.2	2671	0.021	0.015	GCN1_MOUSE Stalled ribosome sensor GCN1 OS=Mus musculus OX=10090 GN=Gcn1 PE=1 SV=1
12	P33892	0.002	45.4	2672	0.049	0.034	GCN1_YEAST eIF-2-alpha kinase activator GCN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN1 PE=1 SV=1
13	O60100	0.12	39.7	1067	0.029	0.050	IMB4_SCHPO Probable importin subunit beta-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kap123 PE=3 SV=1
14	B3CJ34	0.35	38.5	2634	0.035	0.025	B3CJ34_CAEEL TOG domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gcn-1 PE=1 SV=3
15	Q8BFY9	0.38	38.1	898	0.014	0.029	TNPO1_MOUSE Transportin-1 OS=Mus musculus OX=10090 GN=Tnpo1 PE=1 SV=2
16	Q3SYU7	0.39	38.1	898	0.014	0.029	TNPO1_BOVIN Transportin-1 OS=Bos taurus OX=9913 GN=TNPO1 PE=1 SV=2
17	Q92973	0.40	38.1	898	0.014	0.029	TNPO1_HUMAN Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1 PE=1 SV=2
18	C8VUP5	1.2	36.6	939	0.011	0.022	C8VUP5_EMENI KapC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00926 PE=4 SV=1
19	Q38BV5	1.2	36.6	866	0.022	0.046	Q38BV5_TRYB2 Importin beta-1 subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4720 PE=4 SV=1
20	O14787	1.3	36.6	897	0.014	0.028	TNPO2_HUMAN Transportin-2 OS=Homo sapiens OX=9606 GN=TNPO2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	0.47	20.6	Adaptin N terminal region
2	PF12348 CLASP_N	9.8e+02	10.7	CLASP N terminal
3	PF13001 Ecm29	2.2e-149	510.0	Proteasome stabiliser
4	PF02985 HEAT	1.2e-09	48.6	HEAT repeat
5	PF13646 HEAT_2	5.1e-08	44.5	HEAT repeats
6	PF13513 HEAT_EZ	2.9e-07	42.2	HEAT-like repeat
7	PF10363 RTP1_C1	6.9e+02	11.8	Required for nuclear transport of RNA pol II C-terminus 1
8	PF12755 Vac14_Fab1_bd	1.2e-09	50.0	Vacuolar 14 Fab1-binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000259335

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386541	0.994	26S proteasome non-ATPase regulatory subunit 14
2	9606.ENSP00000348442	0.990	26S proteasome non-ATPase regulatory subunit 12
3	9606.ENSP00000357879	0.986	26S proteasome non-ATPase regulatory subunit 4
4	9606.ENSP00000215071	0.981	26S proteasome non-ATPase regulatory subunit 8
5	9606.ENSP00000264639	0.980	26S proteasome non-ATPase regulatory subunit 3
6	9606.ENSP00000481029	0.978	26S proteasome regulatory subunit 6A
7	9606.ENSP00000157812	0.976	26S proteasome regulatory subunit 6B
8	9606.ENSP00000401802	0.976	26S proteasome regulatory subunit 10B
9	9606.ENSP00000261712	0.973	26S proteasome non-ATPase regulatory subunit 11
10	9606.ENSP00000396937	0.966	Proteasome 26S subunit, non-ATPase 13
11	9606.ENSP00000219313	0.964	26S proteasome non-ATPase regulatory subunit 7
12	9606.ENSP00000478877	0.958	Proteasomal ubiquitin receptor ADRM1
13	9606.ENSP00000391211	0.951	26S proteasome regulatory subunit 7
14	9606.ENSP00000418695	0.936	Proteasome 26S subunit, non-ATPase 6
15	9606.ENSP00000261303	0.925	26S proteasome regulatory subunit 4
16	9606.ENSP00000310572	0.920	26S proteasome regulatory subunit 8
17	9606.ENSP00000309474	0.911	26S proteasome non-ATPase regulatory subunit 1
18	9606.ENSP00000384211	0.901	Proteasome activator complex subunit 4
19	9606.ENSP00000310129	0.897	26S proteasome non-ATPase regulatory subunit 2
20	9606.ENSP00000261601	0.895	Ubiquitin carboxyl-terminal hydrolase 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0070628	1.000	proteasome binding
GO:0097159	0.402	organic cyclic compound binding
GO:1901363	0.398	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019941	0.988	modification-dependent protein catabolic process
GO:0010498	0.986	proteasomal protein catabolic process
GO:0034976	0.979	response to endoplasmic reticulum stress
GO:0006511	0.974	ubiquitin-dependent protein catabolic process
GO:0043161	0.961	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0036503	0.946	ERAD pathway
GO:0030433	0.929	ubiquitin-dependent ERAD pathway
GO:0065007	0.485	biological regulation
GO:0050789	0.484	regulation of biological process
GO:0071840	0.394	cellular component organization or biogenesis
GO:0050794	0.356	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.968	protein-containing complex
GO:0005829	0.967	cytosol
GO:0012505	0.943	endomembrane system
GO:0031982	0.885	vesicle
GO:0016020	0.787	membrane
GO:0097708	0.677	intracellular vesicle
GO:0031410	0.668	cytoplasmic vesicle
GO:0005768	0.621	endosome
GO:0005856	0.584	cytoskeleton
GO:0005815	0.526	microtubule organizing center
GO:0005783	0.506	endoplasmic reticulum
GO:0005770	0.490	late endosome
GO:0030135	0.484	coated vesicle
GO:0030139	0.461	endocytic vesicle
GO:0030134	0.451	COPII-coated ER to Golgi transport vesicle
GO:0005771	0.438	multivesicular body
GO:0005769	0.433	early endosome
GO:0005813	0.432	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]