StarFunc result for job id Q5VYP0

User Input

>input (1347 residues)
MENLPFPLKLLSASSLNAPSSTPWVLDIFLTLVFALGFFFLLLPYLSYFRCDDPPSPSPG
KRKCPVGRRRRPRGRMKNHSLRAGRECRRGLEETSDLLSQLQSLLGPHLDKGDFGQLSGP
DPPGEVGERAPDGASQSSHEPMEDAAPILSLLASPDPQAKHPQDLASTPSPGPMTTSVSS
LSASQPPEPSLPLEHPSPEPPALFPHPPHTPDPLACSLPPPKGFTAPPLRDSTLITPSHC
DSVALPLGTVPQSLSPHEDLVASVPAISGLGGSNSHVSASSRWQETARTSCAFNSSVQQD
HLSRHPPETCQMEAGSLFLLSSDGQNVVGIQVTETAKVNIWEEKENVGSFTNRMTPEKHL
NSLRNLAKSLDAEQDTTNPKPFWNMGENSKQLPGPQKLSDPRLWQESFWKNYSQLFWGLP
SLHSESLVANAWVTDRSYTLQSPPFLFNEMSNVCPIQRETTMSPLLFQAQPLSHLGPECQ
PFISSTPQFRPTPMAQAEAQAHLQSSFPVLSPAFPSLIQNTGVACPASQNKVQALSLPET
QHPEWPLLRRQLEGRLALPSRVQKSQDVFSVSTPNLPQESLTSILPENFPVSPELRRQLE
QHIKKWIIQHWGNLGRIQESLDLMQLQDESPGTSQAKGKPSPWQSSMSTGESSKEAQKVK
FQLERDPCPHLGQILGETPQNLSRDMKSFPRKVLGVTSEELERNLRKPLRSDSGSDLLRC
TERTHIENILKAHMGRNLGQTNEGLIPVRVRRSWLAVNQALPVSNTHVKTSNLAAPKSGK
ACVNTAQVLSFLEPCTQQGLGAHIVRFWAKHRWGLPLRVLKPIQCFKLEKVSSLSLTQLA
GPSSATCESGAGSEVEVDMFLRKPPMASLRKQVLTKASDHMPESLLASSPAWKQFQRAPR
GIPSWNDHEPLKPPPAGQEGRWPSKPLTYSLTGSTQQSRSLGAQSSKAGETREAVPQCRV
PLETCMLANLQATSEDVHGFEAPGTSKSSLHPRVSVSQDPRKLCLMEEVVSEFEPGMATK
SETQPQVCAAVVLLPDGQASVVPHASENLVSQVPQGHLQSMPTGNMRASQELHDLMAARR
SKLVHEEPRKPNCQGSCKSQRPMFPPIHKSEKFRKPNLEKHEERLEGLRTPQLTPVRKTE
DTHQDEGVQLLPSKKQPPSVSPFGENIKQIFQWIFSKKKSKPAPVTAESQKTVKNRSCVY
SSSAEAQGLMTAVGQMLDEKMSLCHARHASKVNQHKQKFQAPVCGFPCNHRHLFYSEHGR
ILSYAASSQQATLKSQGCPNRDRQIRNQQPLKSVRCNNEQWGLRHPQILHPKKAVSPVSP
PQHWPKTSGASSHHHHCPRHCLLWEGI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IWB4	0.152	0.152	0.000	1347	0.991	0.991	Q8IWB4.pdb.gz	S31A7_HUMAN Spermatogenesis-associated protein 31A7 OS=Homo sapiens OX=9606 GN=SPATA31A7 PE=1 SV=4
2	AFDB:M9PB01	0.051	0.033	1.589E-4	2397	0.150	0.084	M9PB01.pdb.gz	M9PB01_DROME WD repeat domain 62, isoform G OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
3	AFDB:Q9BYP7	0.038	0.032	2.950E-3	1800	0.147	0.110	Q9BYP7.pdb.gz	WNK3_HUMAN Serine/threonine-protein kinase WNK3 OS=Homo sapiens OX=9606 GN=WNK3 PE=1 SV=3
4	AFDB:P70365	0.037	0.038	3.402E-3	1447	0.125	0.116	P70365.pdb.gz	NCOA1_MOUSE Nuclear receptor coactivator 1 OS=Mus musculus OX=10090 GN=Ncoa1 PE=1 SV=2
5	AFDB:Q5SW79	0.036	0.033	6.015E-3	1584	0.136	0.116	Q5SW79.pdb.gz	CE170_HUMAN Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1
6	AFDB:Q6AI39	0.040	0.047	1.414E-2	1079	0.114	0.143	Q6AI39.pdb.gz	BICRL_HUMAN BRD4-interacting chromatin-remodeling complex-associated protein-like OS=Homo sapiens OX=9606 GN=BICRAL PE=1 SV=2
7	AFDB:Q8CHP0	0.044	0.055	2.169E-2	950	0.131	0.186	Q8CHP0.pdb.gz	ZC3H3_MOUSE Zinc finger CCCH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Zc3h3 PE=1 SV=1
8	AFDB:Q8I398	0.043	0.030	2.169E-2	2112	0.117	0.075	Q8I398.pdb.gz	Q8I398_PLAF7 Nucleoporin NUP221, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0905100 PE=4 SV=1
9	AFDB:Q63624	0.043	0.045	2.329E-2	1258	0.137	0.146	Q63624.pdb.gz	SFR19_RAT Splicing factor, arginine/serine-rich 19 OS=Rattus norvegicus OX=10116 GN=Scaf1 PE=1 SV=2
10	AFDB:M9PGK7	0.036	0.023	2.501E-2	2272	0.139	0.082	M9PGK7.pdb.gz	M9PGK7_DROME Klarsicht, isoform E OS=Drosophila melanogaster OX=7227 GN=klar PE=1 SV=1
11	PDB:7nac7	0.024	0.175	7.396	129	0.016	0.171	7nac7.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
12	PDB:7nb6A	0.031	0.100	7.942	340	0.015	0.059	7nb6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IWB4	0.0	2707	1347	0.992	0.992	S31A7_HUMAN Spermatogenesis-associated protein 31A7 OS=Homo sapiens OX=9606 GN=SPATA31A7 PE=1 SV=4
2	B6VQA5	7.97e-150	483	1048	0.267	0.344	SPT31_RAT Spermatogenesis-associated protein 31 OS=Rattus norvegicus OX=10116 GN=Spata31 PE=1 SV=1
3	Q6NLX7	0.021	40.0	179	0.021	0.156	Q6NLX7_ARATH At4g36660 OS=Arabidopsis thaliana OX=3702 GN=AP22.12 PE=1 SV=1
4	Q6ZU69	0.023	41.6	1335	0.018	0.018	S31F1_HUMAN Protein SPATA31F1 OS=Homo sapiens OX=9606 GN=SPATA31F1 PE=2 SV=4
5	F5H212	2.4	35.0	2717	0.032	0.016	F5H212_HUMAN HIVEP zinc finger 1 OS=Homo sapiens OX=9606 GN=HIVEP1 PE=1 SV=2
6	P15822	2.5	35.0	2718	0.032	0.016	ZEP1_HUMAN Zinc finger protein 40 OS=Homo sapiens OX=9606 GN=HIVEP1 PE=1 SV=4
7	A6NFR6	4.1	33.9	353	0.070	0.266	CE060_HUMAN Uncharacterized protein C5orf60 OS=Homo sapiens OX=9606 GN=C5orf60 PE=1 SV=2
8	A0A024R7N1	7.0	33.5	970	0.019	0.027	A0A024R7N1_HUMAN GMIP (Fragment) OS=Homo sapiens OX=9606 GN=GMIP PE=4 SV=1
9	Q9P107	7.0	33.5	970	0.019	0.027	GMIP_HUMAN GEM-interacting protein OS=Homo sapiens OX=9606 GN=GMIP PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15371 DUF4599	3.9e-18	76.9	Domain of unknown function (DUF4599)
2	PF14650 FAM75	3.8e-127	436.6	FAM75 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000485118

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000478671	0.595	Contactin-associated protein-like 3B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.964	cellular process
GO:0065007	0.514	biological regulation
GO:0008152	0.400	metabolic process
GO:0071704	0.339	organic substance metabolic process
GO:0006807	0.338	nitrogen compound metabolic process
GO:0032502	0.311	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0012505	0.981	endomembrane system
GO:0030141	0.947	secretory granule
GO:0001669	0.860	acrosomal vesicle
GO:0043233	0.679	organelle lumen
GO:0032991	0.410	protein-containing complex
GO:0070013	0.376	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]