StarFunc result for job id Q5VYS8

User Input

>input (1495 residues)
MGDTAKPYFVKRTKDRGTMDDDDFRRGHPQQDYLIIDDHAKGHGSKMEKGLQKKKITPGN
YGNTPRKGPCAVSSNPYAFKNPIYSQPAWMNDSHKDQSKRWLSDEHTGNSDNWREFKPGP
RIPVINRQRKDSFQENEDGYRWQDTRGCRTVRRLFHKDLTSLETTSEMEAGSPENKKQRS
RPRKPRKTRNEENEQDGDLEGPVIDESVLSTKELLGLQQAEERLKRDCIDRLKRRPRNYP
TAKYTCRLCDVLIESIAFAHKHIKEKRHKKNIKEKQEEELLTTLPPPTPSQINAVGIAID
KVVQEFGLHNENLEQRLEIKRIMENVFQHKLPDCSLRLYGSSCSRLGFKNSDVNIDIQFP
AIMSQPDVLLLVQECLKNSDSFIDVDADFHARVPVVVCREKQSGLLCKVSAGNENACLTT
KHLTALGKLEPKLVPLVIAFRYWAKLCSIDRPEEGGLPPYVFALMAIFFLQQRKEPLLPV
YLGSWIEGFSLSKLGNFNLQDIEKDVVIWEHTDSAAGDTGITKEEAPRETPIKRGQVSLI
LDVKHQPSVPVGQLWVELLRFYALEFNLADLVISIRVKELVSRELKDWPKKRIAIEDPYS
VKRNVARTLNSQPVFEYILHCLRTTYKYFALPHKITKSSLLKPLNAITCISEHSKEVINH
HPDVQTKDDKLKNSVLAQGPGATSSAANTCKVQPLTLKETAESFGSPPKEEMGNEHISVH
PENSDCIQADVNSDDYKGDKVYHPETGRKNEKEKVGRKGKHLLTVDQKRGEHVVCGSTRN
NESESTLDLEGFQNPTAKECEGLATLDNKADLDGESTEGTEELEDSLNHFTHSVQGQTSE
MIPSDEEEEDDEEEEEEEEPRLTINQREDEDGMANEDELDNTYTGSGDEDALSEEDDELG
EAAKYEDVKECGKHVERALLVELNKISLKEENVCEEKNSPVDQSDFFYEFSKLIFTKGKS
PTVVCSLCKREGHLKKDCPEDFKRIQLEPLPPLTPKFLNILDQVCIQCYKDFSPTIIEDQ
AREHIRQNLESFIRQDFPGTKLSLFGSSKNGFGFKQSDLDVCMTINGLETAEGLDCVRTI
EELARVLRKHSGLRNILPITTAKVPIVKFFHLRSGLEVDISLYNTLALHNTRLLSAYSAI
DPRVKYLCYTMKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQQRNPPVIPVLQEIYKGEK
KPEIFVDGWNIYFFDQIDELPTYWSECGKNTESVGQLWLGLLRFYTEEFDFKEHVISIRR
KSLLTTFKKQWTSKYIVIEDPFDLNHNLGAGLSRKMTNFIMKAFINGRRVFGIPVKGFPK
DYPSKMEYFFDPDVLTEGELAPNDRCCRICGKIGHFMKDCPMRRKVRRRRDQEDALNQRY
PENKEKRSKEDKEIHNKYTEREVSTKEDKPIQCTPQKAKPMRAAADLGREKILRPPVEKW
KRQDDKDLREKRCFICGREGHIKKECPQFKGSSGSLSSKYMTQGKASAKRTQQES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5BLK4	0.680	0.682	0.000	1491	0.807	0.809	Q5BLK4.pdb.gz	TUT7_MOUSE Terminal uridylyltransferase 7 OS=Mus musculus OX=10090 GN=Tut7 PE=1 SV=3
2	AFDB:Q5VYS8	1.000	1.000	0.000	1495	1.000	1.000	Q5VYS8.pdb.gz	TUT7_HUMAN Terminal uridylyltransferase 7 OS=Homo sapiens OX=9606 GN=TUT7 PE=1 SV=1
3	PDB:4ud5B	0.199	0.810	2.599E-20	342	0.068	0.295	4ud5B.pdb.gz
4	PDB:4e7xD	0.192	0.837	1.473E-19	320	0.066	0.309	4e7xD.pdb.gz
5	AFDB:Q9VYS4	0.183	0.198	2.755E-19	1373	0.130	0.142	Q9VYS4.pdb.gz	GLD2B_DROME Poly(A) RNA polymerase gld-2 homolog B OS=Drosophila melanogaster OX=7227 GN=wisp PE=1 SV=1
6	PDB:2q0eA	0.170	0.723	1.289E-13	331	0.052	0.236	2q0eA.pdb.gz	Dual role of the RNA substrate in selectivity and catalysis by terminal uridylyl transferases.
7	PDB:3hj1B	0.190	0.675	4.511E-13	387	0.043	0.165	3hj1B.pdb.gz	Structure of the Mitochondrial Editosome-Like Complex Associated TUTase 1 Reveals Divergent Mechanisms of UTP Selection and Domain Organization.
8	PDB:2q0cB	0.161	0.694	2.234E-11	311	0.051	0.244	2q0cB.pdb.gz	Dual role of the RNA substrate in selectivity and catalysis by terminal uridylyl transferases.
9	PDB:2b51A	0.184	0.584	1.610E-10	444	0.046	0.155	2b51A.pdb.gz	Structural basis for UTP specificity of RNA editing TUTases from Trypanosoma brucei.
10	AFDB:F4JH01	0.165	0.166	1.219E-9	1481	0.096	0.097	F4JH01.pdb.gz	F4JH01_ARATH Nucleotidyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=MEE44 PE=1 SV=1
11	PDB:3c66A	0.149	0.378	3.257E-7	529	0.034	0.096	3c66A.pdb.gz	Structure of yeast poly(A) polymerase in complex with a peptide from Fip1, an intrinsically disordered protein.
12	AFDB:F4JFF2	0.157	0.179	3.588E-7	1303	0.060	0.069	F4JFF2.pdb.gz	F4JFF2_ARATH Nucleotidyltransferase OS=Arabidopsis thaliana OX=3702 GN=NTP8 PE=1 SV=1
13	PDB:2nomB	0.115	0.615	4.392E-6	255	0.045	0.263	2nomB.pdb.gz	UTP-bound and Apo Structures of a Minimal RNA Uridylyltransferase.
14	PDB:5wyjCB	0.149	0.199	7.462E-6	1098	0.032	0.044	5wyjCB.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
15	PDB:4rwnA	0.147	0.542	5.645E-5	349	0.031	0.132	4rwnA.pdb.gz	The Activation Mechanism of 2'-5'-Oligoadenylate Synthetase Gives New Insights Into OAS/cGAS Triggers of Innate Immunity.
16	AFDB:O77086	0.039	0.038	7.328E-3	1571	0.096	0.091	O77086.pdb.gz	C3G_DROME Guanine nucleotide-releasing factor 2 OS=Drosophila melanogaster OX=7227 GN=C3G PE=1 SV=4
17	AFDB:O96221	0.036	0.036	1.131E-2	1471	0.078	0.079	O96221.pdb.gz	O96221_PLAF7 Protein transport protein SEC31 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0214100 PE=3 SV=3
18	AFDB:Q550K8	0.044	0.033	2.329E-2	2454	0.137	0.084	Q550K8.pdb.gz	Y7071_DICDI Probable serine/threonine-protein kinase DDB_G0277071 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277071 PE=3 SV=1
19	AFDB:Q5EXX3	0.029	0.034	3.770E-2	1203	0.088	0.109	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
20	AFDB:Q20440	0.040	0.040	6.722E-2	1510	0.090	0.089	Q20440.pdb.gz	Q20440_CAEEL START domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gei-1 PE=1 SV=5

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DFM7	0.0	615	1645	0.193	0.175	A0A0C4DFM7_HUMAN RNA uridylyltransferase OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=1
2	B2RX14	0.0	618	1644	0.195	0.177	TUT4_MOUSE Terminal uridylyltransferase 4 OS=Mus musculus OX=10090 GN=Tut4 PE=1 SV=2
3	Q5BLK4	0.0	2401	1491	0.809	0.812	TUT7_MOUSE Terminal uridylyltransferase 7 OS=Mus musculus OX=10090 GN=Tut7 PE=1 SV=3
4	Q5TAX3	0.0	615	1644	0.193	0.176	TUT4_HUMAN Terminal uridylyltransferase 4 OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=3
5	Q5VYS8	0.0	3104	1495	1.000	1.000	TUT7_HUMAN Terminal uridylyltransferase 7 OS=Homo sapiens OX=9606 GN=TUT7 PE=1 SV=1
6	X6R3Q3	0.0	1628	784	0.524	1.000	X6R3Q3_HUMAN RNA uridylyltransferase OS=Homo sapiens OX=9606 GN=TUT7 PE=1 SV=1
7	E9PKY2	1.79e-171	549	1203	0.171	0.212	E9PKY2_HUMAN RNA uridylyltransferase (Fragment) OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=1
8	E9PKX1	2.39e-147	475	906	0.161	0.266	E9PKX1_HUMAN RNA uridylyltransferase (Fragment) OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=1
9	Q09409	1.11e-65	248	1425	0.112	0.117	Q09409_CAEEL RNA uridylyltransferase OS=Caenorhabditis elegans OX=6239 GN=cid-1 PE=1 SV=1
10	O64642	2.44e-49	191	764	0.071	0.139	URT1_ARATH UTP:RNA uridylyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=URT1 PE=1 SV=2
11	Q91YI6	6.02e-39	155	484	0.072	0.221	GLD2_MOUSE Poly(A) RNA polymerase GLD2 OS=Mus musculus OX=10090 GN=Tent2 PE=1 SV=1
12	Q6PIY7	8.19e-39	154	484	0.071	0.219	GLD2_HUMAN Poly(A) RNA polymerase GLD2 OS=Homo sapiens OX=9606 GN=TENT2 PE=1 SV=1
13	Q641A1	1.01e-38	154	509	0.066	0.194	GLD2A_XENLA Poly(A) RNA polymerase GLD2-A OS=Xenopus laevis OX=8355 GN=tent2-a PE=1 SV=1
14	Q5U315	2.18e-38	153	484	0.071	0.219	GLD2_RAT Poly(A) RNA polymerase GLD2 OS=Rattus norvegicus OX=10116 GN=Tent2 PE=1 SV=1
15	Q9UT49	2.72e-38	154	578	0.074	0.190	CID13_SCHPO Poly(A) RNA polymerase cid13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cid13 PE=1 SV=1
16	Q09408	3.48e-37	150	508	0.064	0.187	Q09408_CAEEL PAP-associated domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pup-2 PE=1 SV=2
17	O13833	6.85e-35	141	405	0.069	0.254	CID1_SCHPO Terminal uridylyltransferase cid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cid1 PE=1 SV=2
18	O74326	1.78e-31	132	478	0.056	0.176	CID11_SCHPO Poly(A) RNA polymerase cid11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cid11 PE=3 SV=1
19	A0A0A8K9B1	8.88e-27	121	874	0.054	0.092	A0A0A8K9B1_HUMAN Speckle targeted PIP5K1A-regulated poly(A) polymerase OS=Homo sapiens OX=9606 GN=URLC6 PE=2 SV=1
20	Q9H6E5	8.88e-27	121	874	0.054	0.092	STPAP_HUMAN Speckle targeted PIP5K1A-regulated poly(A) polymerase OS=Homo sapiens OX=9606 GN=TUT1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01909 NTP_transf_2	0.093	24.4	Nucleotidyltransferase domain
2	PF03828 PAP_assoc	6.4e-24	95.3	Cid1 family poly A polymerase
3	PF18765 Polbeta	3.2e+02	12.9	Polymerase beta, Nucleotidyltransferase
4	PF09249 tRNA_NucTransf2	7.7	18.2	tRNA nucleotidyltransferase, second domain
5	PF19088 TUTase	3.8e-115	394.3	TUTase nucleotidyltransferase domain
6	PF16631 TUTF7_u4	1.7e-39	145.5	Unstructured region 4 on terminal uridylyltransferase 7
7	PF12756 zf-C2H2_2	3.2e+02	13.0	C2H2 type zinc-finger (2 copies)
8	PF12171 zf-C2H2_jaz	9.4e+02	11.5	Zinc-finger double-stranded RNA-binding
9	PF00098 zf-CCHC	1.8e-10	51.6	Zinc knuckle
10	PF13696 zf-CCHC_2	0.26	22.4	Zinc knuckle
11	PF14392 zf-CCHC_4	1.8	19.6	Zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365130

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363314	0.963	Protein lin-28 homolog A
2	9606.ENSP00000313007	0.936	Polyadenylate-binding protein 1
3	9606.ENSP00000388806	0.915	Eukaryotic translation initiation factor 4B
4	9606.ENSP00000416255	0.913	Eukaryotic translation initiation factor 4 gamma 1
5	9606.ENSP00000425561	0.913	Eukaryotic translation initiation factor 4E
6	9606.ENSP00000315569	0.910	DIS3-like exonuclease 2
7	9606.ENSP00000293831	0.907	Eukaryotic initiation factor 4A-I
8	9606.ENSP00000326381	0.907	Eukaryotic initiation factor 4A-II
9	9606.ENSP00000269349	0.906	Eukaryotic initiation factor 4A-III
10	9606.ENSP00000302768	0.906	Polyadenylate-binding protein-interacting protein 1
11	9606.ENSP00000321711	0.711	DIS3-like exonuclease 1
12	9606.ENSP00000238714	0.707	Poly(A) polymerase gamma
13	9606.ENSP00000437256	0.685	Endoribonuclease Dicer
14	9606.ENSP00000414921	0.674	Polypyrimidine tract-binding protein 3
15	9606.ENSP00000344401	0.673	Protein lin-28 homolog B
16	9606.ENSP00000366997	0.666	Exosome complex exonuclease RRP44
17	9606.ENSP00000443410	0.653	Putative nucleotidyltransferase FAM46D
18	9606.ENSP00000366135	0.651	Exosome component 10
19	9606.ENSP00000365773	0.632	Phosphoserine aminotransferase
20	9606.ENSP00000264951	0.628	5'-3' exoribonuclease 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0050265	1.000	RNA uridylyltransferase activity
GO:0035198	0.998	miRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0050794	0.996	regulation of cellular process
GO:0044237	0.996	cellular metabolic process
GO:0048519	0.995	negative regulation of biological process
GO:0061157	0.991	mRNA destabilization
GO:0006402	0.988	mRNA catabolic process
GO:0006396	0.975	RNA processing
GO:0031123	0.934	RNA 3'-end processing
GO:0034470	0.915	ncRNA processing
GO:0031047	0.881	RNA-mediated gene silencing
GO:0035196	0.873	miRNA processing
GO:0000956	0.873	nuclear-transcribed mRNA catabolic process
GO:0000288	0.724	nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:0000289	0.618	nuclear-transcribed mRNA poly(A) tail shortening
GO:0010529	0.602	negative regulation of transposition

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.996	nucleoplasm
GO:0043232	0.618	intracellular non-membrane-bounded organelle
GO:0032991	0.433	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14785	1.000	RNA(n) + UTP = diphosphate + RNA(n)-3'-uridine ribonucleotide
EC:2.7.7.52	1.000	RNA uridylyltransferase.

[back to server]