StarFunc result for job id Q5VYV7

User Input

>input (408 residues)
MASKKFAVKCGNFAVLVDLHILPQGSNKDTSWFSEQKKEEVCLLLKETIDSRVQEYLEVR
KQHRPSNAEFTRSNPLSLKGYGFQITAYFLKRGIRLRCIRSTQNAELCVFPDRFVVCVSQ
LAFSRDLLASQNEDLTERVLHGVSDYFAECAESSLPPSAKLRRNALKEIVKRTETKSSVT
SKSQTRRDTVETSSDSVIAEIARRRNDGQASSSPPSESMGQAKDSIKAAESHWGLPVQKL
EKVNQTQPEDTSGQQKPHPGERLKTGLLSRSPVCSCESASPCPKQSPRVAKTQQKRRNCS
SAEDFDHHGRVSLGSDRLVPREIIVEKSKAVRVLPASELSDPGLLLKQDLAKTTSKEELH
VLESLSSRHLMKNNPGQAQQTGLATNTERLSTIQNSPTKKRKKYERGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VYV7	0.999	0.999	2.689E-64	408	1.000	1.000	Q5VYV7.pdb.gz	SLX4I_HUMAN Protein SLX4IP OS=Homo sapiens OX=9606 GN=SLX4IP PE=1 SV=1
2	AFDB:A0A0U3JVR0	0.086	0.088	2.320E-2	371	0.137	0.151	A0A0U3JVR0.pdb.gz
3	AFDB:E1BUG7	0.079	0.054	6.422E-2	690	0.150	0.088	E1BUG7.pdb.gz	SPT2_CHICK Protein SPT2 homolog OS=Gallus gallus OX=9031 GN=SPTY2D1 PE=1 SV=3
4	AFDB:P40791	0.089	0.070	7.773E-2	540	0.125	0.094	P40791.pdb.gz	MEF2_DROME Myocyte-specific enhancer factor 2 OS=Drosophila melanogaster OX=7227 GN=Mef2 PE=1 SV=3
5	AFDB:A0A068EUV3	0.091	0.091	1.069E-1	411	0.140	0.139	A0A068EUV3.pdb.gz
6	AFDB:Q91Y20	0.066	0.032	1.214E-1	946	0.120	0.052	Q91Y20.pdb.gz	PCDAA_MOUSE Protocadherin alpha-10 OS=Mus musculus OX=10090 GN=Pcdha10 PE=2 SV=1
7	AFDB:Q14814	0.100	0.082	1.668E-1	521	0.135	0.106	Q14814.pdb.gz	MEF2D_HUMAN Myocyte-specific enhancer factor 2D OS=Homo sapiens OX=9606 GN=MEF2D PE=1 SV=1
8	AFDB:Q68D10	0.084	0.056	2.604E-1	685	0.157	0.093	Q68D10.pdb.gz	SPT2_HUMAN Protein SPT2 homolog OS=Homo sapiens OX=9606 GN=SPTY2D1 PE=1 SV=3
9	AFDB:P16884	0.067	0.030	2.958E-1	1072	0.140	0.053	P16884.pdb.gz	NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus OX=10116 GN=Nefh PE=1 SV=4
10	AFDB:B7YZY1	0.100	0.047	3.152E-1	1229	0.123	0.041	B7YZY1.pdb.gz	B7YZY1_DROME Sodium/hydrogen exchanger OS=Drosophila melanogaster OX=7227 GN=Nhe2 PE=3 SV=1
11	PDB:3jd5E	0.079	0.096	3.283E-1	328	0.066	0.082	3jd5E.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
12	PDB:7u06G	0.094	0.187	3.499E-1	158	0.039	0.101	7u06G.pdb.gz
13	PDB:7o4iR	0.060	0.084	3.974E-1	268	0.029	0.045	7o4iR.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
14	PDB:6o9lT	0.077	0.121	5.463E-1	237	0.037	0.063	6o9lT.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
15	PDB:2j3tC	0.111	0.241	5.822E-1	141	0.049	0.142	2j3tC.pdb.gz
16	PDB:6cfwK	0.102	0.209	5.822E-1	166	0.034	0.084	6cfwK.pdb.gz	Structure of an Ancient Respiratory System.
17	PDB:5ymxA	0.098	0.177	7.047E-1	202	0.032	0.064	5ymxA.pdb.gz	Allosteric regulation of a prokaryotic small Ras-like GTPase contributes to cell polarity oscillations in bacterial motility.
18	PDB:5n9yA	0.075	0.089	7.510E-1	327	0.032	0.040	5n9yA.pdb.gz
19	PDB:3kioC	0.083	0.212	8.003E-1	113	0.010	0.035	3kioC.pdb.gz
20	PDB:7b6dD	0.073	0.118	8.003E-1	219	0.051	0.096	7b6dD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5VYV7	0.0	837	408	1.000	1.000	SLX4I_HUMAN Protein SLX4IP OS=Homo sapiens OX=9606 GN=SLX4IP PE=1 SV=1
2	Q382E4	0.49	34.3	226	0.042	0.075	Q382E4_TRYB2 U3 small nucleolar ribonucleoprotein protein IMP3, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5500 PE=3 SV=1
3	P11046	1.0	34.3	1788	0.051	0.012	LAMB1_DROME Laminin subunit beta-1 OS=Drosophila melanogaster OX=7227 GN=LanB1 PE=1 SV=4
4	O80623	2.9	32.7	815	0.091	0.045	Y2393_ARATH Probable receptor-like protein kinase At2g39360 OS=Arabidopsis thaliana OX=3702 GN=At2g39360 PE=1 SV=1
5	Q07653	3.8	32.3	1046	0.042	0.016	HBT1_YEAST Protein HBT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HBT1 PE=1 SV=1
6	Q99698	3.9	32.3	3801	0.056	0.006	LYST_HUMAN Lysosomal-trafficking regulator OS=Homo sapiens OX=9606 GN=LYST PE=1 SV=3
7	E5FYH1	6.1	32.0	1653	0.044	0.011	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
8	P12008	6.3	31.2	361	0.032	0.036	AROC_ECOLI Chorismate synthase OS=Escherichia coli (strain K12) OX=83333 GN=aroC PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15744 UPF0492	5.8e-184	623.1	Uncharacterized protein family UPF0492

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000335557

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000294008	0.935	Structure-specific endonuclease subunit SLX4
2	9606.ENSP00000013807	0.845	DNA excision repair protein ERCC-1
3	9606.ENSP00000251303	0.828	SLX1 structure-specific endonuclease subunit homolog A (S. cerevisiae)
4	9606.ENSP00000328940	0.828	Structure-specific endonuclease subunit SLX1
5	9606.ENSP00000353868	0.815	PC-esterase domain containing 1A
6	9606.ENSP00000307853	0.801	Crossover junction endonuclease MUS81
7	9606.ENSP00000310520	0.774	DNA repair endonuclease XPF
8	9606.ENSP00000300086	0.760	Telomeric repeat-binding factor 2-interacting protein 1
9	9606.ENSP00000202816	0.746	ESF1 homolog
10	9606.ENSP00000376952	0.727	Crossover junction endonuclease EME1
11	9606.ENSP00000351475	0.721	PAS domain-containing serine/threonine-protein kinase
12	9606.ENSP00000359423	0.682	Myotubularin
13	9606.ENSP00000265081	0.649	DNA mismatch repair protein Msh3
14	9606.ENSP00000262919	0.627	Attractin
15	9606.ENSP00000438465	0.597	Serine/threonine-protein phosphatase PGAM5, mitochondrial
16	9606.ENSP00000474182	0.592	Leucine-, glutamate- and lysine-rich protein 1
17	9606.ENSP00000254942	0.587	Telomeric repeat-binding factor 2
18	9606.ENSP00000405965	0.537	Small ubiquitin-related modifier 2
19	9606.ENSP00000290399	0.523	Single-minded homolog 2
20	9606.ENSP00000376522	0.515	Centrosomal protein 112

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0071704	0.991	organic substance metabolic process
GO:0044237	0.983	cellular metabolic process
GO:0065007	0.975	biological regulation
GO:0044238	0.974	primary metabolic process
GO:0050789	0.972	regulation of biological process
GO:0043170	0.960	macromolecule metabolic process
GO:0050794	0.949	regulation of cellular process
GO:0006807	0.928	nitrogen compound metabolic process
GO:0006139	0.842	nucleobase-containing compound metabolic process
GO:0090304	0.811	nucleic acid metabolic process
GO:0050896	0.778	response to stimulus
GO:0048519	0.698	negative regulation of biological process
GO:0019222	0.603	regulation of metabolic process
GO:0060255	0.547	regulation of macromolecule metabolic process
GO:0071840	0.540	cellular component organization or biogenesis
GO:0080090	0.536	regulation of primary metabolic process
GO:0051171	0.536	regulation of nitrogen compound metabolic process
GO:0031323	0.536	regulation of cellular metabolic process
GO:0044260	0.509	cellular macromolecule metabolic process
GO:0006259	0.497	DNA metabolic process
GO:0016043	0.496	cellular component organization
GO:0006950	0.492	response to stress
GO:0048523	0.491	negative regulation of cellular process
GO:0019219	0.433	regulation of nucleobase-containing compound metabolic process
GO:0051716	0.411	cellular response to stimulus
GO:0009892	0.372	negative regulation of metabolic process
GO:0006996	0.368	organelle organization
GO:0010605	0.361	negative regulation of macromolecule metabolic process
GO:0033554	0.335	cellular response to stress
GO:0051128	0.328	regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0005694	0.952	chromosome
GO:0005737	0.687	cytoplasm
GO:0098687	0.646	chromosomal region
GO:0032991	0.473	protein-containing complex
GO:0016604	0.438	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]