StarFunc result for job id Q5VZ19

User Input

>input (366 residues)
MSWNISHPQLSDKLFGKNGVLEEQKSPGFKKRETEVYVGNLPLDISKEEILYLLKDFNPL
DVHKIQNGCKCFAFVDLGSMQKVTLAIQELNGKLFHKRKLFVNTSKRPPKRTPDMIQQPR
APLVLEKASGEGFGKTAAIIQLAPKAPVDLCETEKLRAAFFAVPLEMRGSFLVLLLRECF
RDLSWLALIHSVRGEAGLLVTSIVPKTPFFWAMHVTEALHQNMQALFSTLAQAEEQQPYL
EGSTVMRGTRCLAEYHLGDYGHAWNRCWVLDRVDTWAVVMFIDFGQLATIPVQSLRSLDS
DDFWTIPPLTQPFMLEKDILSSYEVVHRILKGKITGALNSAVTAPASNLAVVPPLLPLGC
LQQAAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VK05	0.293	0.125	2.797E-9	903	0.139	0.056	A0A140VK05.pdb.gz	A0A140VK05_HUMAN Testicular secretory protein Li 5 OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:E7FLX9	0.288	0.128	3.994E-9	874	0.134	0.056	E7FLX9.pdb.gz	E7FLX9_PIG A kinase anchor protein 1 OS=Sus scrofa OX=9823 GN=AKAP1 PE=2 SV=1
3	AFDB:O08715	0.301	0.137	1.309E-8	857	0.131	0.056	O08715.pdb.gz	AKAP1_MOUSE A-kinase anchor protein 1, mitochondrial OS=Mus musculus OX=10090 GN=Akap1 PE=1 SV=4
4	AFDB:Q90WE3	0.283	0.058	1.660E-8	1905	0.123	0.024	Q90WE3.pdb.gz	TDRD6_XENLA Tudor domain-containing 6-like OS=Xenopus laevis OX=8355 GN=tdrd6 PE=1 SV=1
5	AFDB:Q9VCU7	0.295	0.162	3.591E-8	691	0.123	0.065	Q9VCU7.pdb.gz	VRET_DROME Protein vreteno OS=Drosophila melanogaster OX=7227 GN=vret PE=1 SV=1
6	AFDB:F1R237	0.305	0.060	3.810E-8	2117	0.153	0.026	F1R237.pdb.gz	TDRD6_DANRE Tudor domain-containing 6 OS=Danio rerio OX=7955 GN=tdrd6 PE=1 SV=2
7	AFDB:Q9VE55	0.298	0.069	6.126E-8	1857	0.131	0.026	Q9VE55.pdb.gz	Q9VE55_DROME Qin OS=Drosophila melanogaster OX=7227 GN=qin PE=1 SV=4
8	AFDB:Q19328	0.304	0.128	7.768E-8	914	0.093	0.037	Q19328.pdb.gz	Q19328_CAEEL Staphylococcal nuclease domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tsn-1 PE=1 SV=1
9	AFDB:Q8NDG6	0.276	0.078	9.850E-8	1382	0.117	0.031	Q8NDG6.pdb.gz	TDRD9_HUMAN ATP-dependent RNA helicase TDRD9 OS=Homo sapiens OX=9606 GN=TDRD9 PE=2 SV=3
10	AFDB:Q99MV1	0.298	0.099	9.850E-8	1172	0.142	0.044	Q99MV1.pdb.gz	TDRD1_MOUSE Tudor domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tdrd1 PE=1 SV=2
11	PDB:5vsuA	0.197	0.187	1.139E-4	387	0.052	0.049	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
12	PDB:5yzg1	0.190	0.282	1.361E-4	243	0.090	0.136	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
13	PDB:6gd1A	0.190	0.356	1.831E-4	190	0.052	0.100	6gd1A.pdb.gz
14	PDB:5gm6V	0.189	0.508	2.188E-4	128	0.063	0.180	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	PDB:6exnY	0.192	0.734	2.464E-4	87	0.057	0.241	6exnY.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
16	PDB:6ff7X	0.193	0.395	2.944E-4	171	0.049	0.105	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	PDB:6qx91K	0.199	0.352	3.124E-4	201	0.030	0.055	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
18	PDB:6lurD	0.193	0.321	3.733E-4	213	0.057	0.099	6lurD.pdb.gz	Revisiting biomolecular NMR spectroscopy for promoting small-molecule drug discovery.
19	PDB:3lqvB	0.183	0.555	4.734E-4	115	0.041	0.130	3lqvB.pdb.gz	Branch Recognition by SF3b14
20	PDB:6c0fo	0.188	0.482	5.023E-4	133	0.046	0.128	6c0fo.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9ZUU4	4.24e-06	50.1	289	0.074	0.093	CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP29B PE=1 SV=1
2	Q2UK72	2.19e-05	48.9	765	0.109	0.052	PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pab1 PE=3 SV=1
3	Q01560	2.87e-05	48.1	414	0.079	0.070	NOP3_YEAST Serine/arginine (SR)-type shuttling mRNA binding protein NPL3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NPL3 PE=1 SV=1
4	Q8VYM4	3.40e-05	47.0	253	0.055	0.079	PSRP2_ARATH Small ribosomal subunit protein cS22 OS=Arabidopsis thaliana OX=3702 GN=PSRP2 PE=2 SV=1
5	Q6NV05	5.94e-05	47.4	556	0.101	0.067	Q6NV05_DANRE RNA binding motif protein 14 OS=Danio rerio OX=7955 GN=zgc:85696 PE=1 SV=1
6	A0A0R4IJ04	6.04e-05	47.4	556	0.101	0.067	A0A0R4IJ04_DANRE RNA binding motif protein 14 isoform X3 OS=Danio rerio OX=7955 GN=rbm14 PE=1 SV=2
7	O22173	1.64e-04	45.8	662	0.101	0.056	PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana OX=3702 GN=PAB4 PE=1 SV=1
8	Q9ZUJ3	3.43e-04	44.3	258	0.071	0.101	Q9ZUJ3_ARATH AT1G60000 protein OS=Arabidopsis thaliana OX=3702 GN=At1g60000 PE=1 SV=1
9	F4I3B3	8.04e-04	43.5	445	0.071	0.058	RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana OX=3702 GN=RBP47A PE=2 SV=1
10	Q04836	0.001	43.1	329	0.074	0.082	CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP31A PE=1 SV=1
11	Q08212	0.001	43.1	465	0.060	0.047	Q08212_DROME Polyadenylate-binding protein OS=Drosophila melanogaster OX=7227 GN=Rox8 PE=2 SV=1
12	Q58EK5	0.001	43.5	1175	0.082	0.026	TDRD1_DANRE Tudor domain-containing protein 1 OS=Danio rerio OX=7955 GN=tdrd1 PE=1 SV=2
13	Q803E7	0.001	43.5	620	0.068	0.040	Q803E7_DANRE Polyadenylate-binding protein OS=Danio rerio OX=7955 GN=zgc:55855 PE=1 SV=1
14	Q8IMX4	0.001	42.7	470	0.060	0.047	Q8IMX4_DROME FI04408p OS=Drosophila melanogaster OX=7227 GN=Rox8 PE=1 SV=1
15	Q8SZP5	0.001	43.1	470	0.060	0.047	Q8SZP5_DROME RE71384p OS=Drosophila melanogaster OX=7227 GN=Rox8 PE=2 SV=1
16	Q96DU9	0.001	42.7	382	0.066	0.063	PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens OX=9606 GN=PABPC5 PE=1 SV=1
17	Q99MV1	0.001	43.1	1172	0.096	0.030	TDRD1_MOUSE Tudor domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tdrd1 PE=1 SV=2
18	Q9FXA2	0.001	43.1	671	0.077	0.042	PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana OX=3702 GN=PAB8 PE=1 SV=1
19	Q9VCE3	0.001	43.1	464	0.060	0.047	Q9VCE3_DROME Rox8, isoform B OS=Drosophila melanogaster OX=7227 GN=Rox8 PE=1 SV=1
20	Q8BL97	0.002	42.0	267	0.068	0.094	SRSF7_MOUSE Serine/arginine-rich splicing factor 7 OS=Mus musculus OX=10090 GN=Srsf7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	2.3e-05	35.4	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
2	PF13893 RRM_5	39	15.4	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF00567 TUDOR	1e-06	40.2	Tudor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357465

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000390621	0.780	Putative ATP-dependent RNA helicase TDRD12
2	9606.ENSP00000357812	0.771	Tudor and KH domain-containing protein
3	9606.ENSP00000255324	0.757	RING finger protein 17
4	9606.ENSP00000387303	0.698	ATP-dependent RNA helicase TDRD9
5	9606.ENSP00000406052	0.674	Tudor domain-containing protein 5
6	9606.ENSP00000346065	0.635	Tudor domain-containing protein 6
7	9606.ENSP00000348132	0.629	Serine/threonine kinase 31
8	9606.ENSP00000353650	0.627	Fatty acid-binding protein 12
9	9606.ENSP00000223073	0.611	RNA-binding protein 28
10	9606.ENSP00000353796	0.556	Ankyrin repeat domain-containing protein 53
11	9606.ENSP00000346762	0.554	Staphylococcal nuclease domain-containing protein 1
12	9606.ENSP00000384376	0.536	Tudor domain containing 15
13	9606.ENSP00000265022	0.528	Diacylglycerol kinase gamma
14	9606.ENSP00000251864	0.527	Tudor domain-containing protein 1
15	9606.ENSP00000484945	0.518	PRAC2 small nuclear protein
16	9606.ENSP00000347444	0.508	Tudor domain-containing protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003729	0.716	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0065007	0.985	biological regulation
GO:0050789	0.984	regulation of biological process
GO:0060255	0.954	regulation of macromolecule metabolic process
GO:0071704	0.914	organic substance metabolic process
GO:0032501	0.906	multicellular organismal process
GO:0044237	0.905	cellular metabolic process
GO:0044238	0.903	primary metabolic process
GO:0006807	0.878	nitrogen compound metabolic process
GO:0032502	0.857	developmental process
GO:0043170	0.855	macromolecule metabolic process
GO:0046483	0.842	heterocycle metabolic process
GO:0034641	0.827	cellular nitrogen compound metabolic process
GO:1901360	0.826	organic cyclic compound metabolic process
GO:0006139	0.818	nucleobase-containing compound metabolic process
GO:0090304	0.807	nucleic acid metabolic process
GO:0007276	0.732	gamete generation
GO:0003006	0.707	developmental process involved in reproduction
GO:0016070	0.703	RNA metabolic process
GO:0022412	0.666	cellular process involved in reproduction in multicellular organism
GO:0050794	0.631	regulation of cellular process
GO:0010468	0.554	regulation of gene expression
GO:0010467	0.428	gene expression
GO:0006396	0.353	RNA processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0043226	0.992	organelle
GO:0005829	0.984	cytosol
GO:0043229	0.982	intracellular organelle
GO:0043231	0.805	intracellular membrane-bounded organelle
GO:0005634	0.750	nucleus
GO:0043232	0.462	intracellular non-membrane-bounded organelle
GO:0035770	0.380	ribonucleoprotein granule
GO:0043233	0.372	organelle lumen
GO:0036464	0.366	cytoplasmic ribonucleoprotein granule
GO:0070013	0.319	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]