StarFunc result for job id Q5VZ89

User Input

>input (1909 residues)
MIEDKGPRVTDYFVVAGLTDTSTLLDQEINRLDTKSTGPKAPITDIAIIIKSAGETVPEG
YTCVEATPSALQANLNYGSLKSPELFLCYKRGRDKPPLTDIGVLYEGKERLIPGCEVILA
TPYGRCANVNNSSTTSQRIFITYRRAPPVRPQNSLAVTDICVIVTSKGETPPHTFCKVDK
NLNCGMWGSSVFLCYKKSVPASNAIAYKAGLIFRYPEEDYESFPLSESDVPLFCLPMGAT
IECWDPETKYPLPVFSTFVLTGSSAKKVYGAAIQFYEPYSRELLSEKQLMHLGLLTPVER
KMVSKSINTNKCICLLSHWPFFEAFRKFLMFIYKLSVSGPHPLPIEKHISHFMQNIPFPS
PQRPRILVQLSVHDALILSQPVSTPLPLSGANFSTLLMNLGPENCATLLLFVLLESKILL
HSLRPAVLTGVAEAVVAMIFPFQWQCPYIPLCPLSLAAVLSAPLPFIVGVDSRYFDLHDP
PQDVVCIDLDTNMLYVSDEKKNMNWKQLPKKPCKNLLSTLKKLYPQLSSVHQKTQEGSAI
DMTPIEADFSWQKKMTQLEMEIQEAFLRFMASILKGYRTYLRPITEAPSNKATAADSLFD
RQGFLKSRDRAYAKFYTLLSKTQIFIRFIEECSFVSDKDTGLAFFDDCIEKLFPDKGTEK
TDKVDFDSAEDTRLIELDDSQKSEHTVFIMPPEPPPDDGKDLSPKYSYKYFPRLDLKLFD
RPQELKLCFSRHPTGNSITKSPPLMAKRTKQEIKTAHKLAKRCYTNPPQWAKCLFSHCYS
LWFICLPAYVRVSHPKVRALQQAYDVLIKMRKTDVDPLDEVCYRVVMQLCGLWGHPVLAV
RVLFEMKTARIKPNAITYGYYNKVVLESPWPSSTRSGIFLWTKVRNVVRGLAQFRQPLKK
TVQRSQVSSISGGQSDQGYGSKDELIKDDAEIHVPEEQAARELITKTKMQTEEVCDASAI
VAKHSQPSPEPHSPTEPPAWGSSIVKVPSGIFDVNSRKSSTGSISNVLFSTQDPVEDAVF
GEATNLKKNGDRGEKRQKHFPERSCSFSSESRAGMLLKKSSLDSNSSEMAIMMGADAKIL
TAALTCPKTSLLHIARTHSFENVSCHLPDSRTCMSESTWNPEHRSSPVPEMLEESQELLE
PVVDDVPKTTATVDTYESLLSDSNSNQSRDLKTVSKDLRNKRSSLYGIAKVVQREDVETG
LDPLSLLATECTGGKTPDSEDKLFSPVIARNLADEIESYMNLKSPLGSKSSSMELHREEN
RESGMTTAFIHALERRSSLPLDHGSPAQENPESEKSSPAVSRSKTFTGRFKQQTPSRTHK
ERSTSLSALVRSSPHGSLGSVVNSLSGLKLDNILSGPKIDVLKSGMKQAATVASKMWVAV
ASAYSYSDDEEETNRDYSFPAGLEDHILGENISPNTSISGLVPSELTQSNTSLGSSSSSG
DVGKLHYPTGEVPFPRGMKGQDFEKSDHGSSQNTSMSSIYQNCAMEVLMSSCSQCRACGA
LVYDEEIMAGWTADDSNLNTACPFCKSNFLPLLNIEFKDLRGSASFFLKPSTSGDSLQSG
SIPLANESLEHKPVSSLAEPDLINFMDFPKHNQIITEETGSAVEPSDEIKRASGDVQTMK
ISSVPNSLSKRNVSLTRSHSVGGPLQNIDFTQRPFHGISTVSLPNSLQEVVDPLGKRPNP
PPVSVPYLSPLVLRKELESLLENEGDQVIHTSSFINQHPIIFWNLVWYFRRLDLPSNLPG
LILTSEHCNEGVQLPLSSLSQDSKLVYIQLLWDNINLHQEPREPLYVSWRNFNSEKKSSL
LSEEQQETSTLVETIRQSIQHNNVLKPINLLSQQMKPGMKRQRSLYREILFLSLVSLGRE
NIDIEAFDNEYGIAYNSLSSEILERLQKIDAPPSASVEWCRKCFGAPLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6H8H2	0.660	0.661	0.000	1906	0.870	0.871	A6H8H2.pdb.gz	DEN4C_MOUSE DENN domain-containing protein 4C OS=Mus musculus OX=10090 GN=Dennd4c PE=1 SV=1
2	AFDB:Q5VZ89	1.000	1.000	0.000	1909	1.000	1.000	Q5VZ89.pdb.gz	DEN4C_HUMAN DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=3
3	AFDB:Q7Z401	0.636	0.651	0.000	1863	0.484	0.496	Q7Z401.pdb.gz	MYCPP_HUMAN C-myc promoter-binding protein OS=Homo sapiens OX=9606 GN=DENND4A PE=1 SV=2
4	AFDB:Q9W3D3	0.572	0.651	0.000	1671	0.323	0.369	Q9W3D3.pdb.gz	CRAG_DROME DENN domain-containing protein Crag OS=Drosophila melanogaster OX=7227 GN=Crag PE=1 SV=3
5	PDB:6nzdH	0.054	0.212	2.383E-3	387	0.021	0.103	6nzdH.pdb.gz	Structural mechanism of a Rag GTPase activation checkpoint by the lysosomal folliculin complex.
6	PDB:6ulgL	0.053	0.178	6.791E-3	458	0.027	0.111	6ulgL.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
7	AFDB:Q5D869	0.029	0.028	2.858E-2	1976	0.062	0.060	Q5D869.pdb.gz	NRPE1_ARATH DNA-directed RNA polymerase V subunit 1 OS=Arabidopsis thaliana OX=3702 GN=NRPE1 PE=1 SV=1
8	PDB:8dhbJ	0.054	0.225	3.428E-2	361	0.021	0.111	8dhbJ.pdb.gz	Structural basis for FLCN RagC GAP activation in MiT-TFE substrate-selective mTORC1 regulation.
9	AFDB:Q7Z4V0	0.026	0.041	4.183E-2	828	0.061	0.140	Q7Z4V0.pdb.gz	ZN438_HUMAN Zinc finger protein 438 OS=Homo sapiens OX=9606 GN=ZNF438 PE=1 SV=1
10	PDB:7mgeC	0.066	0.240	4.349E-2	365	0.020	0.107	7mgeC.pdb.gz	Structural basis for the ARF GAP activity and specificity of the C9orf72 complex.
11	AFDB:P0DPF3	0.039	0.056	7.407E-2	1111	0.083	0.143	P0DPF3.pdb.gz	NBPF9_HUMAN Neuroblastoma breakpoint family member 9 OS=Homo sapiens OX=9606 GN=NBPF9 PE=2 SV=1
12	AFDB:Q0WQM3	0.039	0.071	2.554E-1	797	0.070	0.168	Q0WQM3.pdb.gz	Q0WQM3_ARATH Chaperone DnaJ-domain superfamily protein OS=Arabidopsis thaliana OX=3702 GN=SDJ3 PE=1 SV=1
13	AFDB:Q86YC2	0.039	0.053	3.241E-1	1186	0.074	0.120	Q86YC2.pdb.gz	PALB2_HUMAN Partner and localizer of BRCA2 OS=Homo sapiens OX=9606 GN=PALB2 PE=1 SV=1
14	PDB:7mgeB	0.048	0.161	3.533E-1	442	0.011	0.048	7mgeB.pdb.gz	Structural basis for the ARF GAP activity and specificity of the C9orf72 complex.
15	PDB:6ulgN	0.066	0.193	3.886E-1	483	0.031	0.122	6ulgN.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
16	AFDB:M9PGH7	0.023	0.026	4.112E-1	1657	0.063	0.073	M9PGH7.pdb.gz	M9PGH7_DROME G9a, isoform B OS=Drosophila melanogaster OX=7227 GN=G9a PE=1 SV=1
17	PDB:5uu5A	0.026	0.074	5.688E-1	430	0.013	0.058	5uu5A.pdb.gz
18	PDB:6lt0C	0.051	0.186	6.881E-1	385	0.019	0.094	6lt0C.pdb.gz
19	PDB:6lt0B	0.047	0.167	7.569E-1	386	0.014	0.067	6lt0B.pdb.gz
20	PDB:1fw2A	0.032	0.108	1.474	257	0.014	0.105	1fw2A.pdb.gz	Structural investigations of calcium binding and its role in activity and activation of outer membrane phospholipase A from Escherichia coli.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRX3	0.0	681	353	0.175	0.946	A0A0A0MRX3_HUMAN DENN domain containing 4C (Fragment) OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=1
2	A6H8H2	0.0	3337	1906	0.870	0.871	DEN4C_MOUSE DENN domain-containing protein 4C OS=Mus musculus OX=10090 GN=Dennd4c PE=1 SV=1
3	O75064	0.0	963	1496	0.250	0.320	DEN4B_HUMAN DENN domain-containing protein 4B OS=Homo sapiens OX=9606 GN=DENND4B PE=1 SV=4
4	Q5VZ89	0.0	3942	1909	1.000	1.000	DEN4C_HUMAN DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=3
5	Q7Z401	0.0	1654	1863	0.496	0.508	MYCPP_HUMAN C-myc promoter-binding protein OS=Homo sapiens OX=9606 GN=DENND4A PE=1 SV=2
6	Q9W3D3	0.0	763	1671	0.218	0.250	CRAG_DROME DENN domain-containing protein Crag OS=Drosophila melanogaster OX=7227 GN=Crag PE=1 SV=3
7	X6R5W5	0.0	1420	696	0.365	1.000	X6R5W5_HUMAN DENN domain containing 4C (Fragment) OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=1
8	X6RAE7	0.0	1790	881	0.460	0.997	X6RAE7_HUMAN DENN domain containing 4C (Fragment) OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=1
9	Q6ZUT9	6.05e-32	139	1274	0.081	0.121	DEN5B_HUMAN DENN domain-containing protein 5B OS=Homo sapiens OX=9606 GN=DENND5B PE=1 SV=2
10	Q7KSP6	1.63e-29	131	1973	0.062	0.060	Q7KSP6_DROME SET domain binding factor, isoform B OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=1
11	Q6IQ26	1.64e-29	131	1287	0.051	0.076	DEN5A_HUMAN DENN domain-containing protein 5A OS=Homo sapiens OX=9606 GN=DENND5A PE=1 SV=2
12	Q9VGH9	2.22e-29	131	1993	0.062	0.060	Q9VGH9_DROME SET domain binding factor, isoform A OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=3
13	A2RSQ0	3.10e-29	130	1274	0.070	0.104	DEN5B_MOUSE DENN domain-containing protein 5B OS=Mus musculus OX=10090 GN=Dennd5b PE=1 SV=2
14	Q8RXA7	3.75e-29	130	1187	0.050	0.081	SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana OX=3702 GN=SCD1 PE=1 SV=1
15	G3V7Q0	2.83e-28	127	1287	0.049	0.072	DEN5A_RAT DENN domain-containing protein 5A OS=Rattus norvegicus OX=10116 GN=Dennd5a PE=2 SV=1
16	Q6PAL8	3.00e-28	127	1287	0.049	0.072	DEN5A_MOUSE DENN domain-containing protein 5A OS=Mus musculus OX=10090 GN=Dennd5a PE=1 SV=1
17	Q86WG5	3.14e-28	127	1849	0.061	0.063	MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens OX=9606 GN=SBF2 PE=1 SV=1
18	E9PXF8	4.94e-28	126	1872	0.061	0.062	MTMRD_MOUSE Myotubularin-related protein 13 OS=Mus musculus OX=10090 GN=Sbf2 PE=1 SV=1
19	M0RAP5	1.10e-21	105	1893	0.056	0.056	M0RAP5_RAT SET binding factor 1 OS=Rattus norvegicus OX=10116 GN=Sbf1 PE=1 SV=1
20	Q6ZPE2	1.62e-21	105	1867	0.058	0.059	MTMR5_MOUSE Myotubularin-related protein 5 OS=Mus musculus OX=10090 GN=Sbf1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03455 dDENN	1.9e-09	48.8	dDENN domain
2	PF02141 DENN	8.2e-59	210.2	DENN (AEX-3) domain
3	PF13041 PPR_2	8	18.1	PPR repeat family
4	PF13812 PPR_3	17	16.9	Pentatricopeptide repeat domain
5	PF17177 PPR_long	60	14.4	Pentacotripeptide-repeat region of PRORP
6	PF03456 uDENN	2.3e-10	52.1	uDENN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000473565

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264710	0.975	Ras-related protein Rab-10
2	9606.ENSP00000350386	0.901	Rab proteins geranylgeranyltransferase component A 1
3	9606.ENSP00000355511	0.901	Rab proteins geranylgeranyltransferase component A 2
4	9606.ENSP00000394071	0.901	Rab GDP dissociation inhibitor alpha
5	9606.ENSP00000369538	0.900	Rab GDP dissociation inhibitor beta
6	9606.ENSP00000354669	0.740	Ubiquitin carboxyl-terminal hydrolase MINDY-1
7	9606.ENSP00000459943	0.727	Rabankyrin-5
8	9606.ENSP00000286760	0.705	WASP homolog-associated protein with actin, membranes and microtubules
9	9606.ENSP00000328524	0.683	DENN domain-containing protein 5A
10	9606.ENSP00000310933	0.677	MAP kinase-activating death domain protein
11	9606.ENSP00000262291	0.674	Vacuole membrane protein 1
12	9606.ENSP00000373734	0.674	DENN domain-containing protein 5B
13	9606.ENSP00000334836	0.549	BMP-2-inducible protein kinase
14	9606.ENSP00000392065	0.548	RalBP1-associated Eps domain-containing protein 1
15	9606.ENSP00000370889	0.547	DENN domain-containing protein 1C
16	9606.ENSP00000281187	0.542	Vacuolar protein sorting-associated protein 26B
17	9606.ENSP00000366863	0.532	TBC1 domain family member 4
18	9606.ENSP00000362480	0.513	Vacuolar protein sorting-associated protein 26A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0005515	0.896	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:1901652	0.994	response to peptide
GO:0071495	0.992	cellular response to endogenous stimulus
GO:0072657	0.987	protein localization to membrane
GO:1990778	0.984	protein localization to cell periphery
GO:0032869	0.977	cellular response to insulin stimulus
GO:0072659	0.866	protein localization to plasma membrane
GO:0050789	0.749	regulation of biological process
GO:0051234	0.682	establishment of localization
GO:0006810	0.671	transport
GO:0050794	0.650	regulation of cellular process
GO:0051649	0.467	establishment of localization in cell
GO:0016192	0.332	vesicle-mediated transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005829	0.999	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.855	membrane
GO:0005794	0.796	Golgi apparatus
GO:0031982	0.574	vesicle
GO:0031410	0.554	cytoplasmic vesicle
GO:0071944	0.442	cell periphery
GO:0032991	0.419	protein-containing complex
GO:0005886	0.373	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]