StarFunc result for job id Q5VZE5

User Input

>input (725 residues)
MVMKASVDDDDSGWELSMPEKMEKSNTNWVDITQDFEEACRELKLGELLHDKLFGLFEAM
SAIEMMDPKMDAGMIGNQVNRKVLNFEQAIKDGTIKIKDLTLPELIGIMDTCFCCLITWL
EGHSLAQTVFTCLYIHNPDFIEDPAMKAFALGILKICDIAREKVNKAAVFEEEDFQSMTY
GFKMANSVTDLRVTGMLKDVEDDMQRRVKSTRSRQGEERDPEVELEHQQCLAVFSRVKFT
RVLLTVLIAFTKKETSAVAEAQKLMVQAADLLSAIHNSLHHGIQAQNDTTKGDHPIMMGF
EPLVNQRLLPPTFPRYAKIIKREEMVNYFARLIDRIKTVCEVVNLTNLHCILDFFCEFSE
QSPCVLSRSLLQTTFLVDNKKVFGTHLMQDMVKDALRSFVSPPVLSPKCYLYNNHQAKDC
IDSFVTHCVRPFCSLIQIHGHNRARQRDKLGHILEEFATLQDEAEKVDAALHTMLLKQEP
QRQHLACLGTWVLYHNLRIMIQYLLSGFELELYSMHEYYYIYWYLSEFLYAWLMSTLSRA
DGSQMAEERIMEEQQKGRSSKKTKKKKKVRPLSREITMSQAYQNMCAGMFKTMVAFDMDG
KVRKPKFELDSEQVRYEHRFAPFNSVMTPPPVHYLQFKEMSDLNKYSPPPQSPELYVAAS
KHFQQAKMILENIPNPDHEVNRILKVAKPNFVVMKLLAGGHKKESKVPPEFDFSAHKYFP
VVKLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VZE5	1.000	1.000	3.519E-88	725	1.000	1.000	Q5VZE5.pdb.gz	NAA35_HUMAN N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA35 PE=1 SV=1
2	AFDB:Q7T322	0.985	0.986	1.938E-78	724	0.855	0.856	Q7T322.pdb.gz	NAA35_DANRE N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Danio rerio OX=7955 GN=naa35 PE=2 SV=1
3	AFDB:O17003	0.811	0.741	6.055E-27	799	0.258	0.234	O17003.pdb.gz	O17003_CAEEL Protein MAK10 homolog OS=Caenorhabditis elegans OX=6239 GN=natc-1 PE=1 SV=2
4	AFDB:Q9USY3	0.719	0.734	2.456E-20	708	0.172	0.177	Q9USY3.pdb.gz	NAA35_SCHPO N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mak10 PE=1 SV=1
5	PDB:6ygbB	0.711	0.711	3.305E-17	725	0.181	0.181	6ygbB.pdb.gz	Divergent architecture of the heterotrimeric NatC complex explains N-terminal acetylation of cognate substrates.
6	AFDB:Q582D3	0.723	0.713	3.595E-17	736	0.153	0.151	Q582D3.pdb.gz	Q582D3_TRYB2 Mak10 subunit, NatC N(Alpha)-terminal acetyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.330 PE=3 SV=1
7	PDB:7l1kB	0.687	0.747	7.552E-17	660	0.177	0.194	7l1kB.pdb.gz	Molecular mechanism of N-terminal acetylation by the ternary NatC complex.
8	AFDB:Q02197	0.691	0.684	1.808E-16	733	0.181	0.179	Q02197.pdb.gz	NAA35_YEAST N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAK10 PE=1 SV=1
9	AFDB:Q388S7	0.145	0.126	1.947E-2	928	0.097	0.075	Q388S7.pdb.gz	Q388S7_TRYB2 Pentacotripeptide-repeat region of PRORP domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0260 PE=4 SV=1
10	AFDB:A0A140VJY6	0.138	0.165	3.174E-2	578	0.103	0.130	A0A140VJY6.pdb.gz	A0A140VJY6_HUMAN Testicular tissue protein Li 213 OS=Homo sapiens OX=9606 PE=2 SV=1
11	PDB:6zceq	0.141	0.155	4.091E-2	636	0.113	0.129	6zceq.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
12	AFDB:O74436	0.192	0.224	5.790E-2	597	0.112	0.136	O74436.pdb.gz	SRP68_SCHPO Signal recognition particle subunit srp68 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srp68 PE=3 SV=1
13	AFDB:O01763	0.110	0.104	7.531E-2	798	0.109	0.099	O01763.pdb.gz	NCBP1_CAEEL Nuclear cap-binding protein subunit 1 OS=Caenorhabditis elegans OX=6239 GN=ncbp-1 PE=3 SV=3
14	PDB:4hnxA	0.092	0.093	1.982E-1	713	0.098	0.100	4hnxA.pdb.gz	The Protein Complex NatA Binds Inositol Hexakisphosphate and Exhibits Conformational Flexibility
15	PDB:7ntfA	0.102	0.089	2.137E-1	918	0.063	0.050	7ntfA.pdb.gz
16	PDB:6c95A	0.166	0.158	2.392E-1	773	0.112	0.105	6c95A.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
17	PDB:7cunG	0.131	0.116	2.392E-1	895	0.079	0.064	7cunG.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
18	PDB:6tedQ	0.108	0.095	3.354E-1	890	0.112	0.091	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
19	PDB:7wooD	0.095	0.064	3.354E-1	1398	0.113	0.059	7wooD.pdb.gz
20	PDB:7qe7Y	0.098	0.123	4.202E-1	502	0.090	0.129	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5VZE5	0.0	1521	725	1.000	1.000	NAA35_HUMAN N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA35 PE=1 SV=1
2	Q6PHQ8	0.0	1485	725	0.974	0.974	NAA35_MOUSE N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Mus musculus OX=10090 GN=Naa35 PE=1 SV=1
3	Q7T322	0.0	1307	724	0.855	0.856	NAA35_DANRE N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Danio rerio OX=7955 GN=naa35 PE=2 SV=1
4	O17003	1.87e-35	146	799	0.168	0.153	O17003_CAEEL Protein MAK10 homolog OS=Caenorhabditis elegans OX=6239 GN=natc-1 PE=1 SV=2
5	Q9USY3	1.34e-11	70.5	708	0.150	0.154	NAA35_SCHPO N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mak10 PE=1 SV=1
6	Q02197	2.35e-08	60.1	733	0.058	0.057	NAA35_YEAST N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAK10 PE=1 SV=1
7	Q582D3	2.39e-04	47.0	736	0.168	0.166	Q582D3_TRYB2 Mak10 subunit, NatC N(Alpha)-terminal acetyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.330 PE=3 SV=1
8	Q56W79	4.9	32.7	582	0.048	0.060	Q56W79_ARATH AT3G13000 protein OS=Arabidopsis thaliana OX=3702 GN=MGH6.15 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01956 EMC3_TMCO1	9.9e+02	10.8	Integral membrane protein EMC3/TMCO1-like
2	PF04112 Mak10	1.2e-31	121.0	Mak10 subunit, NatC N(alpha)-terminal acetyltransferase
3	PF03248 Rer1	9.2	17.5	Rer1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010376371.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010354303.1	0.997	N(alpha)-acetyltransferase 30, NatC catalytic subunit
2	61622.XP_010358140.1	0.972	N(alpha)-acetyltransferase 11, NatA catalytic subunit
3	61622.XP_010359320.1	0.972	N(alpha)-acetyltransferase 50, NatE catalytic subunit
4	61622.XP_010360033.1	0.967	N(alpha)-acetyltransferase 10, NatA catalytic subunit
5	61622.XP_010351783.1	0.964	N(alpha)-acetyltransferase 15, NatA auxiliary subunit
6	61622.XP_010360273.1	0.962	N-acetyltransferase 8-like isoform X1
7	61622.XP_010382662.1	0.962	N-acetyltransferase 8 like
8	61622.XP_010360701.1	0.959	N(alpha)-acetyltransferase 38, NatC auxiliary subunit
9	61622.XP_010367421.1	0.959	N(alpha)-acetyltransferase 20, NatB catalytic subunit
10	61622.XP_010377106.1	0.955	N(alpha)-acetyltransferase 25, NatB auxiliary subunit
11	61622.XP_010372807.1	0.947	N(alpha)-acetyltransferase 16, NatA auxiliary subunit
12	61622.XP_010374348.1	0.901	N(alpha)-acetyltransferase 60, NatF catalytic subunit
13	61622.XP_010379789.1	0.894	Lysine acetyltransferase 14
14	61622.XP_010354460.1	0.817	Small nuclear ribonucleoprotein polypeptide N
15	61622.XP_010367983.1	0.817	Dystroglycan
16	61622.XP_010377314.1	0.817	Small nuclear ribonucleoprotein polypeptides B and B1
17	61622.XP_010354763.1	0.743	Ubiquitin-associated and SH3 domain-containing protein B
18	61622.XP_010381486.1	0.743	Ubiquitin associated and SH3 domain containing A
19	61622.XP_010363540.1	0.692	ADP ribosylation factor related protein 1
20	61622.XP_010365388.1	0.691	Catalytic subunit of a complex which severs microtubules in an ATP-dependent manner. Microtubule severing may promote rapid reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. Microtubule release from the mitotic spindle poles may allow depolymerization of the microtubule end proximal to the spindle pole, leading to poleward microtubule flux and poleward motion of chromosome. Microtubule release within the cell body of neurons may be required for their transport into neuronal processes by microtubule-dependent motor pr [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.970	regulation of biological process
GO:0050794	0.941	regulation of cellular process
GO:0009987	0.918	cellular process
GO:0048519	0.895	negative regulation of biological process
GO:0048523	0.654	negative regulation of cellular process
GO:0010941	0.626	regulation of cell death
GO:0060548	0.578	negative regulation of cell death
GO:0043067	0.569	regulation of programmed cell death
GO:0071704	0.526	organic substance metabolic process
GO:0044238	0.494	primary metabolic process
GO:0006807	0.484	nitrogen compound metabolic process
GO:0043170	0.473	macromolecule metabolic process
GO:0042981	0.451	regulation of apoptotic process
GO:0010467	0.442	gene expression
GO:0043069	0.358	negative regulation of programmed cell death
GO:0043066	0.349	negative regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0032991	0.994	protein-containing complex
GO:0005829	0.994	cytosol
GO:0005654	0.989	nucleoplasm
GO:0016020	0.983	membrane
GO:1990234	0.955	transferase complex
GO:0140535	0.931	intracellular protein-containing complex
GO:0031248	0.906	protein acetyltransferase complex
GO:0005886	0.892	plasma membrane
GO:0031414	0.760	N-terminal protein acetyltransferase complex
GO:1990904	0.708	ribonucleoprotein complex
GO:0005844	0.554	polysome
GO:0031417	0.466	NatC complex
GO:0012505	0.463	endomembrane system
GO:0043232	0.301	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]