StarFunc result for job id Q5VZK9

User Input

>input (1371 residues)
MTEESSDVPRELIESIKDVIGRKIKISVKKKVKLEVKGDKVENKVLVLTSCRAFLVTARI
PTKLELTFSYLEIHGVVCSKSAQMIVETEKCSISMKMASPEDVSEVLAHIGTCLRKIFPG
LSPVRIMKKVSMEPSERLASLQALWDSQTVAEQGPCGGFSQMYACVCDWLGFSYREEVQW
DVDTIYLTQDTRELNLQDFSHLDHRDLIPIIAALEYNQWFTKLSSKDLKLSTDVCEQILR
VVSRSNRLEELVLENAGLRTDFAQKLASALAHNPNSGLHTINLAGNPLEDRGVSSLSIQF
AKLPKGLKHLNLSKTSLSPKGVNSLSQSLSANPLTASTLVHLDLSGNVLRGDDLSHMYNF
LAQPNAIVHLDLSNTECSLDMVCGALLRGCLQYLAVLNLSRTVFSHRKGKEVPPSFKQFF
SSSLALMHINLSGTKLSPEPLKALLLGLACNHNLKGVSLDLSNCELRSGGAQVLEGCIAE
IHNITSLDISDNGLESDLSTLIVWLSKNRSIQHLALGKNFNNMKSKNLTPVLDNLVQMIQ
DEESPLQSLSLADSKLKTEVTIIINALGSNTSLTKVDISGNGMGDMGAKMLAKALQINTK
LRTVIWDKNNITAQGFQDIAVAMEKNYTLRFMPIPMYDASQALKTNPEKTEDALQKIENY
LLRNHETRKYLQEQAYRLQQGIVTSTTQQMIDRICVKVQDHLNSLRNCGGDAIQEDLKSA
ERLMRDAKNSKTLLPNLYHVGGASWAGASGLLSSPIQETLESMAGEVTRVVDEQLKALLE
SMVDAAENLCPNVMKKAHIRQDLIHASTEKISIPRTFVKNVLLEQSGIDILNKISEVKLT
VASFLSDRIVDEILDALSHCHHKLADHFSRRGKTLPQQESLEIELAEEKPVKRSIITVEE
LTEIERLEDLDTCMMTPKSKRKSIHSRMLRPVSRAFEMEFDLDKALEEVPIHIEDPPFPS
LRQEKRSSGFISELPSEEGKKLEHFTKLRPKRNKKQQPTQAAVCAANIVSQDGEQNGLMG
RVDEGVDEFFTKKVTKMDSKKWSTRGSESHELNEGGDEKKKRDSRKSSGFLNLIKSRSKS
ERPPTILMTEEPSSPKGAVRSPPVDCPRKDTKAAEHNGNSERIEEIKTPDSFEESQGEEI
GKVERSDSKSSPQAGRRYGVQVMGSGLLAEMKAKQEKRAACAQKKLGNDAVSQDSSSPAL
SGVERSDGGGAVPKLHPGLPENRFGLGTPEKNTKAEPKAEAGSRSRSSSSTPTSPKPLLQ
SPKPSLAARPVIPQKPRTASRPDDIPDSPSSPKVALLPPVLKKVPSDKERDGQSSPQPSP
RTFSQEVSRRSWGQQAQEYQEQKQRSSSKDGHQGSKSNDSGEEAEKEFIFV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VZK9	1.000	1.000	0.000	1371	1.000	1.000	Q5VZK9.pdb.gz	CARL1_HUMAN F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1 PE=1 SV=1
2	AFDB:Q6EDY6	0.715	0.714	0.000	1374	0.894	0.892	Q6EDY6.pdb.gz	CARL1_MOUSE F-actin-uncapping protein LRRC16A OS=Mus musculus OX=10090 GN=Carmil1 PE=1 SV=2
3	AFDB:Q8ND23	0.466	0.466	1.402E-85	1372	0.385	0.385	Q8ND23.pdb.gz	CARL3_HUMAN Capping protein, Arp2/3 and myosin-I linker protein 3 OS=Homo sapiens OX=9606 GN=CARMIL3 PE=2 SV=2
4	AFDB:A0A0B4KEE7	0.483	0.447	7.638E-79	1486	0.343	0.316	A0A0B4KEE7.pdb.gz	A0A0B4KEE7_DROME Leucine-rich repeat, isoform F OS=Drosophila melanogaster OX=7227 GN=LRR PE=1 SV=1
5	AFDB:Q6F5E8	0.466	0.446	1.072E-72	1435	0.318	0.304	Q6F5E8.pdb.gz	CARL2_HUMAN Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Homo sapiens OX=9606 GN=CARMIL2 PE=1 SV=2
6	PDB:1a4yA	0.230	0.594	1.214E-9	460	0.064	0.191	1a4yA.pdb.gz
7	PDB:7pzcA	0.203	0.264	2.358E-8	1010	0.066	0.090	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
8	PDB:6o60C	0.199	0.542	1.231E-7	389	0.048	0.170	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
9	PDB:7lfhA	0.197	0.302	2.495E-6	806	0.066	0.113	7lfhA.pdb.gz
10	PDB:2p1nB	0.198	0.400	7.511E-6	571	0.053	0.126	2p1nB.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
11	PDB:4kxfP	0.192	0.284	8.175E-6	866	0.055	0.088	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
12	PDB:1k5dC	0.162	0.485	1.010E-5	344	0.038	0.151	1k5dC.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
13	PDB:3oglB	0.204	0.416	1.054E-5	568	0.043	0.104	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
14	PDB:6npyA	0.189	0.299	4.847E-5	798	0.060	0.103	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
15	PDB:7sa1B	0.200	0.384	8.409E-5	624	0.062	0.136	7sa1B.pdb.gz
16	AFDB:Q96RT1	0.159	0.155	2.053E-4	1412	0.113	0.110	Q96RT1.pdb.gz	ERBIN_HUMAN Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2
17	AFDB:Q6PR54	0.083	0.059	5.922E-4	2419	0.132	0.075	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
18	AFDB:Q9VUH6	0.062	0.054	9.439E-4	1833	0.112	0.083	Q9VUH6.pdb.gz	Q9VUH6_DROME Myopic OS=Drosophila melanogaster OX=7227 GN=mop PE=1 SV=2
19	AFDB:Q5UIP0	0.071	0.051	1.027E-3	2472	0.107	0.059	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
20	AFDB:P29539	0.059	0.055	2.112E-3	1916	0.116	0.083	P29539.pdb.gz	RIF1_YEAST Telomere length regulator protein RIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIF1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KEE7	0.0	704	1486	0.307	0.283	A0A0B4KEE7_DROME Leucine-rich repeat, isoform F OS=Drosophila melanogaster OX=7227 GN=LRR PE=1 SV=1
2	A1Z734	0.0	711	1452	0.305	0.288	A1Z734_DROME Leucine-rich repeat, isoform B OS=Drosophila melanogaster OX=7227 GN=LRR PE=1 SV=2
3	E1JGZ7	0.0	713	1296	0.306	0.324	E1JGZ7_DROME Leucine-rich repeat, isoform G OS=Drosophila melanogaster OX=7227 GN=LRR PE=1 SV=2
4	E1JGZ8	0.0	713	1429	0.306	0.294	E1JGZ8_DROME Leucine-rich repeat, isoform C OS=Drosophila melanogaster OX=7227 GN=LRR PE=1 SV=1
5	Q5VZK9	0.0	2816	1371	1.000	1.000	CARL1_HUMAN F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1 PE=1 SV=1
6	Q6EDY6	0.0	2406	1374	0.894	0.892	CARL1_MOUSE F-actin-uncapping protein LRRC16A OS=Mus musculus OX=10090 GN=Carmil1 PE=1 SV=2
7	Q6F5E8	0.0	583	1435	0.236	0.226	CARL2_HUMAN Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Homo sapiens OX=9606 GN=CARMIL2 PE=1 SV=2
8	Q8ND23	0.0	854	1372	0.349	0.348	CARL3_HUMAN Capping protein, Arp2/3 and myosin-I linker protein 3 OS=Homo sapiens OX=9606 GN=CARMIL3 PE=2 SV=2
9	Q3V3V9	2.54e-172	550	1296	0.220	0.233	CARL2_MOUSE Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Mus musculus OX=10090 GN=Carmil2 PE=1 SV=2
10	Q21301	4.90e-89	315	1056	0.159	0.206	Q21301_CAEEL CARMIL pleckstrin homology domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=crml-1 PE=1 SV=2
11	Q95VZ3	9.08e-76	276	1050	0.132	0.172	CARML_DICDI Protein CARMIL OS=Dictyostelium discoideum OX=44689 GN=carmil PE=1 SV=1
12	Q54G18	3.30e-51	200	1115	0.139	0.171	GACW_DICDI Rho GTPase-activating protein gacW OS=Dictyostelium discoideum OX=44689 GN=gacW PE=3 SV=1
13	Q54B43	9.24e-33	140	861	0.102	0.163	Q54B43_DICDI Leucine-rich repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293920 PE=4 SV=1
14	H3BLT9	7.21e-11	69.7	1112	0.074	0.091	H3BLT9_HUMAN NLR family CARD domain containing 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2
15	C3VPR7	1.19e-10	68.9	1065	0.074	0.095	C3VPR7_HUMAN NLRC3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=2 SV=1
16	Q7RTR2	1.19e-10	68.9	1065	0.074	0.095	NLRC3_HUMAN NLR family CARD domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2
17	Q5DU56	2.33e-08	61.2	1064	0.072	0.093	NLRC3_MOUSE Protein NLRC3 OS=Mus musculus OX=10090 GN=Nlrc3 PE=1 SV=2
18	D4A523	2.56e-08	61.2	1035	0.073	0.097	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
19	Q57ZL7	3.42e-07	57.4	759	0.066	0.119	Q57ZL7_TRYB2 Ribonuclease inhibitor-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27C5.410 PE=4 SV=1
20	P59046	7.43e-07	56.2	1061	0.074	0.095	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20442 BrxL_N	3.9e+02	12.4	BREX system Lon protease-like protein BrxL N-terminal
2	PF16000 CARMIL_C	9.2e-104	358.8	CARMIL C-terminus
3	PF17888 Carm_PH	4.5e-30	115.2	Carmil pleckstrin homology domain
4	PF15036 IL34	1.6e+02	13.8	Interleukin 34
5	PF00560 LRR_1	31	16.4	Leucine Rich Repeat
6	PF12799 LRR_4	7.4	18.4	Leucine Rich repeats (2 copies)
7	PF13516 LRR_6	1.6e-07	41.8	Leucine Rich repeat
8	PF14942 Muted	1.5e+02	14.0	Organelle biogenesis, Muted-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331983

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295314	0.944	Tropomodulin-4
2	9606.ENSP00000354947	0.913	F-actin-capping protein subunit alpha-2
3	9606.ENSP00000401010	0.893	F-actin-capping protein subunit beta
4	9606.ENSP00000352264	0.850	CD2-associated protein
5	9606.ENSP00000352834	0.836	Unconventional myosin-Ic
6	9606.ENSP00000393392	0.836	Unconventional myosin-Ia
7	9606.ENSP00000378757	0.828	Monocarboxylate transporter 9
8	9606.ENSP00000264784	0.806	Solute carrier family 2, facilitated glucose transporter member 9
9	9606.ENSP00000394485	0.794	Na(+)/H(+) exchange regulatory cofactor NHE-RF3
10	9606.ENSP00000304283	0.773	Ras-related C3 botulinum toxin substrate 3
11	9606.ENSP00000362924	0.739	Gelsolin
12	9606.ENSP00000358994	0.732	Unconventional myosin-VI
13	9606.ENSP00000369270	0.728	Ras-responsive element-binding protein 1
14	9606.ENSP00000358120	0.724	Pleckstrin homology domain-containing family O member 1
15	9606.ENSP00000253754	0.720	PDZ and LIM domain protein 4
16	9606.ENSP00000265944	0.720	Myosin-IIIa
17	9606.ENSP00000299106	0.720	Junctional adhesion molecule C
18	9606.ENSP00000343690	0.720	Dihydropyrimidinase-related protein 3
19	9606.ENSP00000367059	0.720	Espin
20	9606.ENSP00000397459	0.720	Dual specificity protein phosphatase 22

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0048522	0.978	positive regulation of cellular process
GO:0051130	0.947	positive regulation of cellular component organization
GO:0033043	0.935	regulation of organelle organization
GO:0051493	0.931	regulation of cytoskeleton organization
GO:0032956	0.923	regulation of actin cytoskeleton organization
GO:0044087	0.899	regulation of cellular component biogenesis
GO:1902903	0.897	regulation of supramolecular fiber organization
GO:0010810	0.895	regulation of cell-substrate adhesion
GO:1900026	0.893	positive regulation of substrate adhesion-dependent cell spreading
GO:0051492	0.890	regulation of stress fiber assembly
GO:0032233	0.871	positive regulation of actin filament bundle assembly
GO:0016043	0.858	cellular component organization
GO:1902743	0.845	regulation of lamellipodium organization
GO:1902745	0.835	positive regulation of lamellipodium organization
GO:0051496	0.832	positive regulation of stress fiber assembly
GO:0040012	0.789	regulation of locomotion
GO:2000145	0.762	regulation of cell motility
GO:0006996	0.748	organelle organization
GO:0030334	0.734	regulation of cell migration
GO:0007010	0.600	cytoskeleton organization
GO:0051179	0.567	localization
GO:0030335	0.510	positive regulation of cell migration
GO:0051234	0.459	establishment of localization
GO:0050896	0.434	response to stimulus
GO:0030029	0.402	actin filament-based process
GO:0030036	0.389	actin cytoskeleton organization
GO:0008152	0.348	metabolic process
GO:0044237	0.340	cellular metabolic process
GO:0006810	0.303	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0120025	0.997	plasma membrane bounded cell projection
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0030027	0.990	lamellipodium
GO:0031981	0.988	nuclear lumen
GO:0005737	0.976	cytoplasm
GO:0032991	0.971	protein-containing complex
GO:0005829	0.966	cytosol
GO:0005886	0.964	plasma membrane
GO:0005576	0.961	extracellular region
GO:0012505	0.956	endomembrane system
GO:0005654	0.946	nucleoplasm
GO:0005856	0.923	cytoskeleton
GO:0070062	0.910	extracellular exosome
GO:0015629	0.841	actin cytoskeleton
GO:0099512	0.796	supramolecular fiber
GO:0099513	0.773	polymeric cytoskeletal fiber
GO:0031410	0.719	cytoplasmic vesicle
GO:0005768	0.522	endosome
GO:0005884	0.431	actin filament
GO:0016604	0.373	nuclear body
GO:0031941	0.358	filamentous actin
GO:0044354	0.357	macropinosome
GO:0031256	0.324	leading edge membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]