StarFunc result for job id Q5VZL5

User Input

>input (1548 residues)
MAEREVESGPRKRFEQKSGAVFDEIVENCGGIMDTEMSEDIDHNLTPTLDSMSYGMPNQT
GSENSLLDEDDYFLNSGDLAGIPVVGSDNEDEQDFSSKDNLVSSIHTDDSLEVERRVTQH
ESDNENEIQIQNKLKKDFPKQFDQVSVFKSIRKDFSLVRENSKETFSGKEKNRDLTYERE
KRLDKPHKDLDSRLKSSFFDKAANQVEETLHTHLPQTPETNFRDSSYPFANKESIGSELG
NSFASNIRIKEEPLDDEYDKAMAPQQGLLDKIKDEPDNAQEYSHGQQQKTQEGELKISAV
FSVSGSPLAPQLTTGFQPSLASSGMNKMLPSVPATAVRVSCSGCKKILQKGQTAYQRKGS
TQLFCSTLCLTGYTVPPARPPPPLTKKTCSSCSKDILNPKDVISAQFENTTTSKDFCSQS
CLSTYELKKKPIVTINTNSISTKCSMCQKNAVIRHEVNYQNVVHKLCSDACFSKFRSANN
LTMNCCENCGGYCYSGSGQCHMLQIEGQSKKFCSSSCITAYKQKSAKITPCALCKSLRSS
AEMIENTNSLGKTELFCSVNCLSAYRVKMVTSAGVQVQCNSCKTSAIPQYHLAMSDGSIR
NFCSYSCVVAFQNLFNKPTGMNSSVVPLSQGQVIVSIPTGSTVSAGGGSTSAVSPTSISS
SAAAGLQRLAAQSQHVGFARSVVKLKCQHCNRLFATKPELLDYKGKMFQFCGKNCSDEYK
KINNVMAMCEYCKIEKIVKETVRFSGADKSFCSEGCKLLYKHDLAKRWGNHCKMCSYCLQ
TSPKLVQNNLGGKVEEFCCEECMSKYTVLFYQMAKCDACKRQGKLSESLKWRGEMKHFCN
LLCILMFCNQQSVCDPPSQNNAANISMVQAASAGPPSLRKDSTPVIANVVSLASAPAAQP
TVNSNSVLQGAVPTVTAKIIGDASTQTDALKLPPSQPPRLLKNKALLCKPITQTKATSCK
PHTQNKECQTEDTPSQPQIIVVPVPVPVFVPIPLHLYTQYAPVPFGIPVPMPVPMLIPSS
MDSEDKVTESIEDIKEKLPTHPFEADLLEMAEMIAEDEEKKTLSQGESQTSEHELFLDTK
IFEKDQGSTYSGDLESEAVSTPHSWEEELNHYALKSNAVQEADSELKQFSKGETEQDLEA
DFPSDSFDPLNKGQGIQARSRTRRRHRDGFPQPRRRGRKKSIVAVEPRSLIQGAFQGCSV
SGMTLKYMYGVNAWKNWVQWKNAKEEQGDLKCGGVEQASSSPRSDPLGSTQDHALSQESS
EPGCRVRSIKLKEDILSCTFAELSLGLCQFIQEVRRPNGEKYDPDSILYLCLGIQQYLFE
NGRIDNIFTEPYSRFMIELTKLLKIWEPTILPNGYMFSRIEEEHLWECKQLGAYSPIVLL
NTLLFFNTKYFQLKNVTEHLKLSFAHVMRRTRTLKYSTKMTYLRFFPPLQKQESEPDKLT
VGKRKRNEDDEVPVGVEMAENTDNPLRCPVRLYEFYLSKCSESVKQRNDVFYLQPERSCV
PNSPMWYSTFPIDPGTLDTMLTRILMVREVHEELAKAKSEDSDVELSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VZL5	1.000	1.000	0.000	1548	1.000	1.000	Q5VZL5.pdb.gz	ZMYM4_HUMAN Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4 PE=1 SV=1
2	AFDB:Q7LBC6	0.045	0.037	1.569E-5	1761	0.109	0.095	Q7LBC6.pdb.gz	KDM3B_HUMAN Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2
3	AFDB:Q91YE5	0.046	0.041	2.288E-5	1889	0.150	0.123	Q91YE5.pdb.gz	BAZ2A_MOUSE Bromodomain adjacent to zinc finger domain protein 2A OS=Mus musculus OX=10090 GN=Baz2a PE=1 SV=2
4	AFDB:E9PEP7	0.051	0.080	2.548E-5	755	0.073	0.150	E9PEP7.pdb.gz	E9PEP7_HUMAN Zinc finger protein X-linked OS=Homo sapiens OX=9606 GN=ZFX PE=1 SV=1
5	AFDB:Q8N1G0	0.049	0.054	2.838E-5	1237	0.116	0.146	Q8N1G0.pdb.gz	ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1
6	AFDB:Q9V5M3	0.034	0.053	3.521E-5	878	0.062	0.109	Q9V5M3.pdb.gz	LOLA6_DROME Longitudinals lacking protein, isoforms N/O/W/X/Y OS=Drosophila melanogaster OX=7227 GN=lola PE=1 SV=3
7	AFDB:S4R1W5	0.034	0.040	4.610E-5	1118	0.101	0.140	S4R1W5.pdb.gz	S4R1W5_MOUSE RNA binding motif protein 6 OS=Mus musculus OX=10090 GN=Rbm6 PE=1 SV=1
8	AFDB:A0A024RC04	0.044	0.063	5.135E-5	805	0.069	0.133	A0A024RC04.pdb.gz
9	AFDB:Q9Y462	0.044	0.072	2.200E-4	761	0.070	0.143	Q9Y462.pdb.gz	ZN711_HUMAN Zinc finger protein 711 OS=Homo sapiens OX=9606 GN=ZNF711 PE=1 SV=2
10	AFDB:Q8IHQ2	0.038	0.043	2.322E-4	1301	0.094	0.111	Q8IHQ2.pdb.gz	Q8IHQ2_PLAF7 Oocyst rupture protein 1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1146600 PE=3 SV=1
11	PDB:4kfzB	0.045	0.228	2.216E-2	148	0.016	0.162	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
12	PDB:1b8tA	0.027	0.150	2.749E-2	192	0.025	0.203	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:6rrdO	0.047	0.112	3.854E-1	504	0.019	0.060	6rrdO.pdb.gz	Molecular insight into RNA polymerase I promoter recognition and promoter melting.
14	PDB:7ls2Q2	0.027	0.356	9.128E-1	110	0.006	0.082	7ls2Q2.pdb.gz	Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.
15	PDB:1nqzA	0.017	0.128	1.483	171	0.005	0.047	1nqzA.pdb.gz
16	PDB:7bxtM	0.032	0.123	1.565	198	0.010	0.081	7bxtM.pdb.gz	Cryo-EM structure of the CENP-A nucleosome in complex with phosphorylated CENP-C.
17	PDB:6qw65B	0.038	0.031	1.743	2001	0.015	0.011	6qw65B.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
18	PDB:6ft6u	0.026	0.239	1.839	150	0.008	0.087	6ft6u.pdb.gz	Structure of the nuclear exosome captured on a maturing preribosome.
19	PDB:7z17D	0.028	0.099	1.839	279	0.011	0.061	7z17D.pdb.gz	Structural remodelling of the carbon-phosphorus lyase machinery by a dual ABC ATPase.
20	PDB:6ip52Q	0.027	0.316	2.682	124	0.006	0.073	6ip52Q.pdb.gz	HCV IRES Captures an Actively Translating 80S Ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NHB5	0.0	764	1372	0.301	0.340	A6NHB5_HUMAN Zinc finger MYM-type containing 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=1
2	O95789	0.0	1000	1325	0.328	0.383	ZMYM6_HUMAN Zinc finger MYM-type protein 6 OS=Homo sapiens OX=9606 GN=ZMYM6 PE=1 SV=2
3	Q14202	0.0	764	1370	0.301	0.340	ZMYM3_HUMAN Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=2
4	Q5VZL5	0.0	3224	1548	1.000	1.000	ZMYM4_HUMAN Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4 PE=1 SV=1
5	Q9CU65	0.0	751	1376	0.311	0.350	ZMYM2_MOUSE Zinc finger MYM-type protein 2 OS=Mus musculus OX=10090 GN=Zmym2 PE=1 SV=3
6	Q9JLM4	0.0	748	1370	0.295	0.334	ZMYM3_MOUSE Zinc finger MYM-type protein 3 OS=Mus musculus OX=10090 GN=Zmym3 PE=1 SV=1
7	Q9UBW7	0.0	759	1377	0.313	0.351	ZMYM2_HUMAN Zinc finger MYM-type protein 2 OS=Homo sapiens OX=9606 GN=ZMYM2 PE=1 SV=1
8	A6NHN7	4.31e-167	540	1280	0.232	0.280	A6NHN7_HUMAN Zinc finger MYM-type containing 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=1
9	A0A0B4K7W6	5.33e-105	353	712	0.165	0.358	A0A0B4K7W6_DROME Without children, isoform C OS=Drosophila melanogaster OX=7227 GN=woc PE=1 SV=1
10	Q95TK6	4.00e-103	357	1043	0.165	0.244	Q95TK6_DROME LD44304p OS=Drosophila melanogaster OX=7227 GN=woc PE=2 SV=1
11	A8JRE3	2.22e-100	358	1703	0.161	0.147	A8JRE3_DROME Without children, isoform B OS=Drosophila melanogaster OX=7227 GN=woc PE=1 SV=1
12	A0A0B4KHZ0	2.87e-100	358	1702	0.163	0.148	A0A0B4KHZ0_DROME Without children, isoform E OS=Drosophila melanogaster OX=7227 GN=woc PE=1 SV=1
13	Q9N9Z6	2.98e-100	358	1688	0.161	0.148	Q9N9Z6_DROME WOC protein OS=Drosophila melanogaster OX=7227 GN=woc PE=4 SV=1
14	Q9VB55	3.32e-100	358	1688	0.161	0.148	Q9VB55_DROME Without children, isoform A OS=Drosophila melanogaster OX=7227 GN=woc PE=1 SV=2
15	A0A0B4KI43	3.46e-100	358	1687	0.161	0.148	A0A0B4KI43_DROME Without children, isoform D OS=Drosophila melanogaster OX=7227 GN=woc PE=1 SV=1
16	Q6AWL3	3.54e-100	358	1688	0.161	0.148	Q6AWL3_DROME RE05635p OS=Drosophila melanogaster OX=7227 GN=woc PE=2 SV=1
17	Q3UA37	8.55e-75	268	777	0.094	0.187	QRIC1_MOUSE Transcriptional regulator QRICH1 OS=Mus musculus OX=10090 GN=Qrich1 PE=1 SV=1
18	A1L3Z9	1.09e-74	268	776	0.094	0.187	A1L3Z9_HUMAN Glutamine-rich 1 OS=Homo sapiens OX=9606 GN=QRICH1 PE=2 SV=1
19	Q2TAL8	1.09e-74	268	776	0.094	0.187	QRIC1_HUMAN Transcriptional regulator QRICH1 OS=Homo sapiens OX=9606 GN=QRICH1 PE=1 SV=1
20	A6NL54	1.60e-47	181	497	0.057	0.177	A6NL54_HUMAN Zinc finger MYM-type containing 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12012 DUF3504	2.8e-62	221.0	Domain of unknown function (DUF3504)
2	PF04945 YHS	1.3e+02	13.9	YHS domain
3	PF06467 zf-FCS	1.8e-47	170.3	MYM-type Zinc finger with FCS sequence motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322915

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000428585	0.782	Small integral membrane protein 12
2	9606.ENSP00000271715	0.758	Pogo transposable element with ZNF domain
3	9606.ENSP00000384367	0.743	BTB/POZ domain-containing protein KCTD1
4	9606.ENSP00000439250	0.724	Peptidyl-prolyl cis-trans isomerase FKBP9
5	9606.ENSP00000234170	0.714	CCAAT/enhancer-binding protein zeta
6	9606.ENSP00000440440	0.690	Activating transcription factor 7-interacting protein 1
7	9606.ENSP00000318900	0.675	Sine oculis-binding protein homolog
8	9606.ENSP00000343966	0.617	Paraspeckle component 1
9	9606.ENSP00000478070	0.615	CWC25 spliceosome associated protein homolog
10	9606.ENSP00000365576	0.598	Ubiquilin-1
11	9606.ENSP00000264010	0.593	Transcriptional repressor CTCF
12	9606.ENSP00000479904	0.569	Zinc finger MYM-type protein 2
13	9606.ENSP00000405965	0.541	Small ubiquitin-related modifier 2
14	9606.ENSP00000322845	0.539	Zinc finger MYM-type protein 3
15	9606.ENSP00000377060	0.536	Chromobox protein homolog 1
16	9606.ENSP00000262241	0.526	REST corepressor 1
17	9606.ENSP00000383042	0.523	Lysine-specific histone demethylase 1A
18	9606.ENSP00000419692	0.522	Retinoic acid receptor RXR-alpha
19	9606.ENSP00000316578	0.519	Polycomb protein SUZ12
20	9606.ENSP00000375593	0.516	Zinc finger and SCAN domain-containing protein 5A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	1.000	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0009987	0.994	cellular process
GO:0071840	0.947	cellular component organization or biogenesis
GO:0016043	0.942	cellular component organization
GO:0006996	0.919	organelle organization
GO:0022604	0.879	regulation of cell morphogenesis
GO:0007010	0.867	cytoskeleton organization
GO:0050794	0.794	regulation of cellular process
GO:0060255	0.635	regulation of macromolecule metabolic process
GO:0080090	0.539	regulation of primary metabolic process
GO:0051171	0.513	regulation of nitrogen compound metabolic process
GO:0031323	0.481	regulation of cellular metabolic process
GO:0019219	0.395	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.330	regulation of gene expression
GO:0006355	0.316	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.729	cytoplasm
GO:0016604	0.620	nuclear body
GO:0005829	0.387	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]