StarFunc result for job id Q5VZP5

User Input

>input (1158 residues)
MATRKDTEEEQVVPSEEDEANVRAVQAHYLRSPSPSQYSMVSDAETESIFMEPIHLSSAI
AAKQIINEELKPPGVRADAECPGMLESAEQLLVEDLYNRVREKMDDTSLYNTPCVLDLQR
ALVQDRQEAPWNEVDEVWPNVFIAEKSVAVNKGRLKRLGITHILNAAHGTGVYTGPEFYT
GLEIQYLGVEVDDFPEVDISQHFRKASEFLDEALLTYRGKVLVSSEMGISRSAVLVVAYL
MIFHNMAILEALMTVRKKRAIYPNEGFLKQLRELNEKLMEEREEDYGREGGSAEAEEGEG
TGSMLGARVHALTVEEEDDSASHLSGSSLGKATQASKPLTLIDEEEEEKLYEQWKKGQGL
LSDKVPQDGGGWRSASSGQGGEELEDEDVERIIQEWQSRNERYQAEGYRRWGREEEKEEE
SDAGSSVGRRRRTLSESSAWESVSSHDIWVLKQQLELNRPDHGRRRRADSMSSESTWDAW
NERLLEIEKEASRRYHAKSKREEAADRSSEAGSRVREDDEDSVGSEASSFYNFCSRNKDK
LTALERWKIKRIQFGFHKKDLGAGDSSGEPGAEEAVGEKNPSDVSLTAYQAWKLKHQKKV
GSENKEEVVELSKGEDSALAKKRQRRLELLERSRQTLEESQSMASWEADSSTASGSIPLS
AFWSADPSVSADGDTTSVLSTQSHRSHLSQAASNIAGCSTSNPTTPLPNLPVGPGDTISI
ASIQNWIANVVSETLAQKQNEMLLLSRSPSVASMKAVPAASCLGDDQVSMLSGHSSSSLG
GCLLPQSQARPSSDMQSVLSCNTTLSSPAESCRSKVRGTSKPIFSLFADNVDLKELGRKE
KEMQMELREKMSEYKMEKLASDNKRSSLFKKKKVKEDEDDGVGDGDEDTDSAIGSFRYSS
RSNSQKPETDTCSSLAVCDHYASGSRVGKEMDSSINKWLSGLRTEEKPPFQSDWSGSSRG
KYTRSSLLRETESKSSSYKFSKSQSEEQDTSSYHEANGNSVRSTSRFSSSSTREGREMHK
FSRSTYNETSSSREESPEPYFFRRTPESSEREESPEPQRPNWARSRDWEDVEESSKSDFS
EFGAKRKFTQSFMRSEEEGEKERTENREEGRFASGRRSQYRRSTDREEEEEMDDEAIIAA
WRRRQEETRTKLQKRRED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QWM2	0.176	0.185	1.181E-67	1100	0.396	0.417	F1QWM2.pdb.gz	STYL2_DANRE Serine/threonine/tyrosine-interacting-like protein 2 OS=Danio rerio OX=7955 GN=styxl2 PE=1 SV=1
2	AFDB:Q6B8I0	0.148	0.888	1.008E-19	188	0.066	0.410	Q6B8I0.pdb.gz	DS13A_MOUSE Dual specificity protein phosphatase 13A OS=Mus musculus OX=10090 GN=Dusp13a PE=2 SV=1
3	AFDB:Q6B8I1	0.150	0.898	4.391E-19	188	0.065	0.399	Q6B8I1.pdb.gz	DS13A_HUMAN Dual specificity protein phosphatase 13A OS=Homo sapiens OX=9606 GN=DUSP13A PE=1 SV=1
4	PDB:2gwoC	0.144	0.936	1.774E-18	174	0.067	0.448	2gwoC.pdb.gz
5	PDB:5xjvB	0.138	0.906	7.727E-18	171	0.066	0.450	5xjvB.pdb.gz
6	PDB:2y96A	0.135	0.876	1.037E-17	175	0.068	0.451	2y96A.pdb.gz
7	PDB:3f81A	0.142	0.895	1.229E-16	179	0.061	0.397	3f81A.pdb.gz	Multidentate small-molecule inhibitors of vaccinia H1-related (VHR) phosphatase decrease proliferation of cervix cancer cells.
8	AFDB:Q76I76	0.126	0.104	6.791E-14	1423	0.133	0.108	Q76I76.pdb.gz	SSH2_HUMAN Protein phosphatase Slingshot homolog 2 OS=Homo sapiens OX=9606 GN=SSH2 PE=1 SV=1
9	PDB:2wgpA	0.120	0.788	3.657E-12	168	0.041	0.286	2wgpA.pdb.gz
10	PDB:6d66A	0.119	0.263	2.869E-11	517	0.041	0.093	6d66A.pdb.gz
11	PDB:5y15A	0.120	0.879	3.424E-11	148	0.038	0.297	5y15A.pdb.gz
12	PDB:2esbA	0.120	0.813	3.022E-10	162	0.035	0.253	2esbA.pdb.gz
13	PDB:4rkkA	0.107	0.360	3.745E-7	317	0.030	0.110	4rkkA.pdb.gz	Structural mechanism of laforin function in glycogen dephosphorylation and lafora disease.
14	PDB:2q05A	0.122	0.679	1.730E-6	181	0.038	0.243	2q05A.pdb.gz
15	AFDB:A8E7B7	0.051	0.052	1.979E-6	1122	0.147	0.152	A8E7B7.pdb.gz
16	AFDB:Q9S7I0	0.047	0.043	9.080E-5	1307	0.115	0.102	Q9S7I0.pdb.gz	TADA_ARATH tRNA(adenine(34)) deaminase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TADA PE=1 SV=1
17	AFDB:Q96PY6	0.049	0.046	8.501E-4	1258	0.117	0.107	Q96PY6.pdb.gz	NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens OX=9606 GN=NEK1 PE=1 SV=2
18	AFDB:Q57VP9	0.053	0.029	9.017E-4	2653	0.107	0.047	Q57VP9.pdb.gz	Q57VP9_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O4.100 PE=4 SV=1
19	AFDB:O94986	0.069	0.053	7.505E-3	1710	0.100	0.068	O94986.pdb.gz	CE152_HUMAN Centrosomal protein of 152 kDa OS=Homo sapiens OX=9606 GN=CEP152 PE=1 SV=4
20	AFDB:Q9BIW6	0.045	0.057	8.954E-3	749	0.080	0.124	Q9BIW6.pdb.gz	Q9BIW6_DROME Brahma-associated protein 111kD OS=Drosophila melanogaster OX=7227 GN=Bap111 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QWM2	0.0	671	1100	0.438	0.461	STYL2_DANRE Serine/threonine/tyrosine-interacting-like protein 2 OS=Danio rerio OX=7955 GN=styxl2 PE=1 SV=1
2	Q68J44	6.09e-44	161	220	0.067	0.355	DUS29_HUMAN Dual specificity phosphatase 29 OS=Homo sapiens OX=9606 GN=DUSP29 PE=1 SV=1
3	Q8BK84	7.03e-43	157	215	0.073	0.395	DUS29_MOUSE Dual specificity phosphatase 29 OS=Mus musculus OX=10090 GN=Dusp29 PE=1 SV=1
4	Q9QYJ7	8.28e-43	157	198	0.068	0.399	DS13B_MOUSE Dual specificity protein phosphatase 13B OS=Mus musculus OX=10090 GN=Dusp13b PE=1 SV=1
5	Q9UII6	1.15e-42	156	198	0.072	0.419	DS13B_HUMAN Dual specificity protein phosphatase 13B OS=Homo sapiens OX=9606 GN=DUSP13B PE=1 SV=3
6	Q6B8I0	1.07e-41	153	188	0.069	0.426	DS13A_MOUSE Dual specificity protein phosphatase 13A OS=Mus musculus OX=10090 GN=Dusp13a PE=2 SV=1
7	Q9BV47	3.39e-41	152	211	0.066	0.360	DUS26_HUMAN Dual specificity protein phosphatase 26 OS=Homo sapiens OX=9606 GN=DUSP26 PE=1 SV=1
8	Q6B8I1	4.04e-40	149	188	0.068	0.420	DS13A_HUMAN Dual specificity protein phosphatase 13A OS=Homo sapiens OX=9606 GN=DUSP13A PE=1 SV=1
9	Q9D700	9.84e-40	148	211	0.068	0.374	DUS26_MOUSE Dual specificity protein phosphatase 26 OS=Mus musculus OX=10090 GN=Dusp26 PE=2 SV=2
10	Q9D7X3	3.20e-34	132	185	0.060	0.373	DUS3_MOUSE Dual specificity protein phosphatase 3 OS=Mus musculus OX=10090 GN=Dusp3 PE=1 SV=1
11	G3V9L3	4.65e-34	132	211	0.060	0.327	G3V9L3_RAT Dual specificity protein phosphatase OS=Rattus norvegicus OX=10116 GN=Dusp3 PE=3 SV=3
12	A0A8I6AF61	6.90e-34	132	212	0.060	0.325	A0A8I6AF61_RAT Dual specificity protein phosphatase OS=Rattus norvegicus OX=10116 GN=Dusp3 PE=1 SV=1
13	B5DFF7	2.23e-33	129	185	0.060	0.373	B5DFF7_RAT Dual specificity protein phosphatase OS=Rattus norvegicus OX=10116 GN=Dusp3 PE=2 SV=1
14	P51452	2.59e-32	126	185	0.058	0.362	DUS3_HUMAN Dual specificity protein phosphatase 3 OS=Homo sapiens OX=9606 GN=DUSP3 PE=1 SV=1
15	E5RHD0	2.00e-19	88.2	145	0.039	0.310	E5RHD0_HUMAN Dual specificity protein phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=DUSP26 PE=1 SV=8
16	Q55CS7	3.69e-17	89.4	834	0.042	0.059	MPL1_DICDI MAP kinase phosphatase with leucine-rich repeats protein 1 OS=Dictyostelium discoideum OX=44689 GN=mpl1 PE=2 SV=1
17	Q9M8K7	1.18e-16	80.9	167	0.046	0.317	DUS1B_ARATH Dual specificity protein phosphatase 1B OS=Arabidopsis thaliana OX=3702 GN=DSPTP1B PE=1 SV=1
18	O95147	9.66e-16	79.3	198	0.047	0.273	DUS14_HUMAN Dual specificity protein phosphatase 14 OS=Homo sapiens OX=9606 GN=DUSP14 PE=1 SV=1
19	Q9VWF4	5.84e-14	77.4	387	0.042	0.127	DUSK4_DROME Dual specificity protein phosphatase MPK-4 OS=Drosophila melanogaster OX=7227 GN=MKP-4 PE=1 SV=1
20	Q62767	8.64e-14	77.0	395	0.042	0.124	DUS4_RAT Dual specificity protein phosphatase 4 OS=Rattus norvegicus OX=10116 GN=Dusp4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	4.5e-22	89.7	Dual specificity phosphatase, catalytic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354483

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343435	0.734	Protein YIF1B
2	9606.ENSP00000339115	0.701	Espin-like protein
3	9606.ENSP00000243389	0.692	Proton-coupled amino acid transporter 1
4	9606.ENSP00000254663	0.649	Selenocysteine lyase
5	9606.ENSP00000282249	0.648	Guanylate cyclase soluble subunit alpha-2
6	9606.ENSP00000264428	0.621	Glycine receptor subunit beta
7	9606.ENSP00000412130	0.621	Protein MRVI1
8	9606.ENSP00000309163	0.618	CAAX prenyl protease 2
9	9606.ENSP00000439281	0.564	Triadin
10	9606.ENSP00000359942	0.548	Kelch-like protein 31
11	9606.ENSP00000312535	0.535	Leucine-rich repeat and fibronectin type-III domain-containing protein 4
12	9606.ENSP00000261800	0.533	Protocadherin Fat 2
13	9606.ENSP00000364515	0.533	BTB/POZ domain-containing protein 17
14	9606.ENSP00000465261	0.526	Transmembrane channel-like protein 6
15	9606.ENSP00000362728	0.523	Importin subunit alpha-7
16	9606.ENSP00000272444	0.521	RNA/RNP complex-1-interacting phosphatase
17	9606.ENSP00000268876	0.520	Protein unc-45 homolog B
18	9606.ENSP00000333926	0.518	Multidrug resistance-associated protein 5
19	9606.ENSP00000301587	0.505	ATP synthase subunit d, mitochondrial
20	9606.ENSP00000449960	0.505	Calcium-binding and coiled-coil domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016791	1.000	phosphatase activity
GO:0005515	0.999	protein binding
GO:0140096	0.996	catalytic activity, acting on a protein
GO:0004721	0.989	phosphoprotein phosphatase activity
GO:0008138	0.665	protein tyrosine/serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071840	0.760	cellular component organization or biogenesis
GO:0016043	0.546	cellular component organization
GO:0008152	0.530	metabolic process
GO:0007010	0.505	cytoskeleton organization
GO:0050789	0.416	regulation of biological process
GO:0044237	0.414	cellular metabolic process
GO:0050794	0.392	regulation of cellular process
GO:0032502	0.365	developmental process
GO:0048856	0.355	anatomical structure development
GO:0030029	0.318	actin filament-based process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005737	0.998	cytoplasm
GO:0016020	0.995	membrane
GO:0043231	0.967	intracellular membrane-bounded organelle
GO:0043228	0.907	non-membrane-bounded organelle
GO:0043232	0.774	intracellular non-membrane-bounded organelle
GO:0031974	0.535	membrane-enclosed lumen
GO:0070013	0.533	intracellular organelle lumen
GO:0005634	0.501	nucleus
GO:0071944	0.472	cell periphery
GO:0005829	0.396	cytosol
GO:0031981	0.378	nuclear lumen
GO:0005654	0.345	nucleoplasm
GO:0005886	0.323	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.

[back to server]