StarFunc result for job id Q5W0Q7

User Input

>input (1092 residues)
MMDSPKIGNGLPVIGPGTDIGISSLHMVGYLGKNFDSAKVPSDEYCPACREKGKLKALKT
YRISFQESIFLCEDLQCIYPLGSKSLNNLISPDLEECHTPHKPQKRKSLESSYKDSLLLA
NSKKTRNYIAIDGGKVLNSKHNGEVYDETSSNLPDSSGQQNPIRTADSLERNEILEADTV
DMATTKDPATVDVSGTGRPSPQNEGCTSKLEMPLESKCTSFPQALCVQWKNAYALCWLDC
ILSALVHSEELKNTVTGLCSKEESIFWRLLTKYNQANTLLYTSQLSGVKDGDCKKLTSEI
FAEIETCLNEVRDEIFISLQPQLRCTLGDMESPVFAFPLLLKLETHIEKLFLYSFSWDFE
CSQCGHQYQNRHMKSLVTFTNVIPEWHPLNAAHFGPCNNCNSKSQIRKMVLEKVSPIFML
HFVEGLPQNDLQHYAFHFEGCLYQITSVIQYRANNHFITWILDADGSWLECDDLKGPCSE
RHKKFEVPASEIHIVIWERKISQVTDKEAACLPLKKTNDQHALSNEKPVSLTSCSVGDAA
SAETASVTHPKDISVAPRTLSQDTAVTHGDHLLSGPKGLVDNILPLTLEETIQKTASVSQ
LNSEAFLLENKPVAENTGILKTNTLLSQESLMASSVSAPCNEKLIQDQFVDISFPSQVVN
TNMQSVQLNTEDTVNTKSVNNTDATGLIQGVKSVEIEKDAQLKQFLTPKTEQLKPERVTS
QVSNLKKKETTADSQTTTSKSLQNQSLKENQKKPFVGSWVKGLISRGASFMPLCVSAHNR
NTITDLQPSVKGVNNFGGFKTKGINQKASHVSKKARKSASKPPPISKPPAGPPSSNGTAA
HPHAHAASEVLEKSGSTSCGAQLNHSSYGNGISSANHEDLVEGQIHKLRLKLRKKLKAEK
KKLAALMSSPQSRTVRSENLEQVPQDGSPNDCESIEDLLNELPYPIDIASESACTTVPGV
SLYSSQTHEEILAELLSPTPVSTELSENGEGDFRYLGMGDSHIPPPVPSEFNDVSQNTHL
RQDHNYCSPTKKNPCEVQPDSLTNNACVRTLNLESPMKTDIFDEFFSSSALNALANDTLD
LPHFDEYLFENY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5W0Q7	0.999	0.999	0.000	1092	1.000	1.000	Q5W0Q7.pdb.gz	USPL1_HUMAN SUMO-specific isopeptidase USPL1 OS=Homo sapiens OX=9606 GN=USPL1 PE=1 SV=1
2	AFDB:Q3ULM6	0.331	0.331	1.613E-100	1089	0.602	0.603	Q3ULM6.pdb.gz	USPL1_MOUSE SUMO-specific isopeptidase USPL1 OS=Mus musculus OX=10090 GN=Uspl1 PE=2 SV=2
3	AFDB:Q9VRP5	0.163	0.170	8.660E-16	1038	0.118	0.124	Q9VRP5.pdb.gz	UBP36_DROME Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila melanogaster OX=7227 GN=scny PE=1 SV=3
4	AFDB:A0A024R8V6	0.178	0.174	1.498E-13	1123	0.125	0.122	A0A024R8V6.pdb.gz
5	AFDB:E7F4C0	0.172	0.170	2.774E-13	1104	0.131	0.130	E7F4C0.pdb.gz	E7F4C0_DANRE Ubiquitin carboxyl-terminal hydrolase 36 OS=Danio rerio OX=7955 GN=usp37 PE=4 SV=2
6	AFDB:B1AQJ2	0.198	0.197	3.103E-13	1098	0.111	0.110	B1AQJ2.pdb.gz	UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus OX=10090 GN=Usp36 PE=1 SV=1
7	AFDB:B2RQC2	0.152	0.130	2.331E-12	1324	0.125	0.103	B2RQC2.pdb.gz	UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus OX=10090 GN=Usp42 PE=1 SV=1
8	AFDB:Q9H9J4	0.163	0.138	5.401E-12	1324	0.124	0.102	Q9H9J4.pdb.gz	UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3
9	PDB:4fjcE	0.138	0.307	5.430E-12	434	0.037	0.092	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
10	PDB:3mhsA	0.179	0.387	1.862E-11	455	0.035	0.084	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
11	PDB:8a9kD	0.156	0.483	2.756E-11	285	0.039	0.151	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
12	PDB:5k16B	0.159	0.461	6.753E-11	328	0.045	0.149	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
13	PDB:5cvnB	0.147	0.428	1.057E-10	321	0.038	0.131	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
14	PDB:7ay1D	0.161	0.417	3.625E-10	341	0.047	0.150	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
15	PDB:3jcrV	0.161	0.370	1.840E-9	431	0.041	0.104	3jcrV.pdb.gz
16	PDB:5k1bA	0.145	0.501	1.946E-9	264	0.038	0.159	5k1bA.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
17	PDB:7w3ax	0.139	0.271	3.811E-9	494	0.031	0.069	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
18	PDB:7yxxA	0.142	0.093	6.309E-9	1754	0.042	0.026	7yxxA.pdb.gz
19	AFDB:P39061	0.056	0.041	1.510E-5	1774	0.154	0.095	P39061.pdb.gz	COIA1_MOUSE Collagen alpha-1(XVIII) chain OS=Mus musculus OX=10090 GN=Col18a1 PE=1 SV=4
20	AFDB:Q5BJ30	0.073	0.070	1.878E-4	1185	0.135	0.124	Q5BJ30.pdb.gz	Q5BJ30_MOUSE Per1 protein OS=Mus musculus OX=10090 GN=Per1 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3ULM6	0.0	1214	1089	0.609	0.611	USPL1_MOUSE SUMO-specific isopeptidase USPL1 OS=Mus musculus OX=10090 GN=Uspl1 PE=2 SV=2
2	Q5W0Q7	0.0	2261	1092	1.000	1.000	USPL1_HUMAN SUMO-specific isopeptidase USPL1 OS=Homo sapiens OX=9606 GN=USPL1 PE=1 SV=1
3	Q6DRC5	6.08e-63	234	1014	0.117	0.126	USPL1_DANRE SUMO-specific isopeptidase USPL1 OS=Danio rerio OX=7955 GN=uspl1 PE=1 SV=1
4	Q7KWI9	0.56	36.2	371	0.027	0.078	Q7KWI9_PLAF7 Beta-ketoacyl-ACP synthase III OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0211400 PE=3 SV=1
5	Q0PBM2	2.6	34.7	769	0.021	0.030	Q0PBM2_CAMJE histidine kinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=cheA PE=1 SV=1
6	O00338	3.8	33.5	296	0.016	0.057	ST1C2_HUMAN Sulfotransferase 1C2 OS=Homo sapiens OX=9606 GN=SULT1C2 PE=1 SV=1
7	A7Z073	3.9	33.9	900	0.019	0.023	A7Z073_BOVIN SNAP91 protein OS=Bos taurus OX=9913 GN=SNAP91 PE=2 SV=1
8	O60641	4.2	33.9	907	0.019	0.023	AP180_HUMAN Clathrin coat assembly protein AP180 OS=Homo sapiens OX=9606 GN=SNAP91 PE=1 SV=2
9	Q61548	4.2	33.9	901	0.019	0.023	AP180_MOUSE Clathrin coat assembly protein AP180 OS=Mus musculus OX=10090 GN=Snap91 PE=1 SV=1
10	Q8I461	4.5	33.9	2393	0.015	0.007	Q8I461_PLAF7 Cation transporting P-ATPase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0504000 PE=3 SV=1
11	I1S9X9	4.9	33.5	888	0.017	0.021	ATG9_GIBZE Autophagy-related protein 9 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ATG9 PE=3 SV=1
12	P28159	6.3	33.1	594	0.018	0.034	SUH_DROME Suppressor of hairless protein OS=Drosophila melanogaster OX=7227 GN=Su(H) PE=1 SV=1
13	Q95RJ1	6.3	32.7	317	0.012	0.041	Q95RJ1_DROME LD27667p OS=Drosophila melanogaster OX=7227 GN=CG8229 PE=2 SV=1
14	A1Z7L6	6.4	33.1	335	0.012	0.039	A1Z7L6_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8229 PE=4 SV=2
15	A1Z7L5	6.7	32.7	293	0.012	0.044	A1Z7L5_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Uspl1l PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15509 DUF4650	4e-238	803.5	Domain of unknown function (DUF4650)
2	PF15499 Peptidase_C98	1.6e-124	426.5	Ubiquitin-specific peptidase-like, SUMO isopeptidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255304

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263256	0.839	Desumoylating isopeptidase 1
2	9606.ENSP00000296564	0.829	Little elongation complex subunit 1
3	9606.ENSP00000306528	0.775	Desumoylating isopeptidase 2
4	9606.ENSP00000261520	0.766	Little elongation complex subunit 2
5	9606.ENSP00000240316	0.743	Coilin
6	9606.ENSP00000262809	0.698	RNA polymerase II elongation factor ELL
7	9606.ENSP00000405965	0.691	Small ubiquitin-related modifier 2
8	9606.ENSP00000156471	0.667	Intron-binding protein aquarius
9	9606.ENSP00000376077	0.666	Small ubiquitin-related modifier 1
10	9606.ENSP00000394791	0.655	Sentrin-specific protease 1
11	9606.ENSP00000327197	0.621	Sentrin-specific protease 5
12	9606.ENSP00000409666	0.608	Small ubiquitin-like modifier 3
13	9606.ENSP00000387006	0.606	Pre-mRNA-splicing factor CWC22 homolog
14	9606.ENSP00000359829	0.597	Ubiquitin carboxyl-terminal hydrolase 33
15	9606.ENSP00000401470	0.588	Ran GTPase-activating protein 1
16	9606.ENSP00000425133	0.583	Protein SMG7
17	9606.ENSP00000386488	0.577	Zinc finger CCCH domain-containing protein 8
18	9606.ENSP00000402527	0.574	Sentrin-specific protease 6
19	9606.ENSP00000377655	0.568	Sentrin-specific protease 7
20	9606.ENSP00000314029	0.566	Sentrin-specific protease 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0032183	1.000	SUMO binding
GO:0016929	1.000	deSUMOylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010467	0.990	gene expression
GO:0016070	0.990	RNA metabolic process
GO:0034660	0.967	ncRNA metabolic process
GO:0098781	0.962	ncRNA transcription
GO:0016073	0.957	snRNA metabolic process
GO:0070647	0.952	protein modification by small protein conjugation or removal
GO:0018193	0.920	peptidyl-amino acid modification
GO:0006508	0.913	proteolysis
GO:0070646	0.903	protein modification by small protein removal
GO:0018205	0.887	peptidyl-lysine modification
GO:0065007	0.626	biological regulation
GO:0050789	0.478	regulation of biological process
GO:0050794	0.448	regulation of cellular process
GO:0071840	0.423	cellular component organization or biogenesis
GO:0016043	0.382	cellular component organization
GO:0019222	0.352	regulation of metabolic process
GO:0006996	0.330	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015030	1.000	Cajal body
GO:0005576	0.998	extracellular region
GO:0005615	0.988	extracellular space
GO:0032991	0.601	protein-containing complex
GO:0005737	0.555	cytoplasm
GO:0043232	0.388	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).

[back to server]